"IFNGR1" Related Products

Expand

Recombinant Human IFNGR1 Protein, His-tagged

Cat.No. : IFNGR1-001H
Product Overview : Recombinant human IFNGR1(18-245aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description : IFNGR1, also known as interferon gamma receptor 1, is a member of the hematopoietic cytokine receptor superfamily. It is a receptor that binds interferon-γ, the sole member of interferon type II. It induces the rapid dimerization of chains, thereby forming a site that is recognized by the extracellular domain of IFNGR2. It is expressed in a membrane-bound form in many cell types, and is over-expressed in tumour cells. Its signaling promotes autoimmune germinal centers via cell-intrinsic induction of BCL-6. It is crucial for host defence against mycobacterial infections. It is associated with susceptibility to pulmonary tuberculosis (TB).
Source : Insect cell
Species : Human
Tag : His
Form : Liquid
Molecular Mass : 26.6 kDa
AASequence : EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGHHHHHH
N-terminal Sequence Analysis : Glu 18
Endotoxin : < 1.0 EU per 1 μg of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1.0 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
SDS-PAGE :

15% SDS-PAGE (3 μg)

Gene Name : IFNGR1 interferon gamma receptor 1 [ Homo sapiens (human) ]
Official Symbol : IFNGR1
Synonyms : IFNGR1; interferon gamma receptor 1; CD119; IFNGR; IMD27A; IMD27B;
Gene ID : 3459
mRNA Refseq : NM_000416
Protein Refseq : NP_000407
MIM : 107470
UniProt ID : P15260

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.