Recombinant Human IFNGR1 Protein, His-tagged

Cat.No. : IFNGR1-001H
Product Overview : Recombinant human IFNGR1(18-245aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability October 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 18-245 a.a.
Description : IFNGR1, also known as interferon gamma receptor 1, is a member of the hematopoietic cytokine receptor superfamily. It is a receptor that binds interferon-γ, the sole member of interferon type II. It induces the rapid dimerization of chains, thereby forming a site that is recognized by the extracellular domain of IFNGR2. It is expressed in a membrane-bound form in many cell types, and is over-expressed in tumour cells. Its signaling promotes autoimmune germinal centers via cell-intrinsic induction of BCL-6. It is crucial for host defence against mycobacterial infections. It is associated with susceptibility to pulmonary tuberculosis (TB).
Form : Liquid
Molecular Mass : 26.6 kDa
N-terminal Sequence Analysis : Glu 18
Endotoxin : < 1.0 EU per 1 μg of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1.0 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
AA Sequence : EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGHHHHHH
Gene Name IFNGR1 interferon gamma receptor 1 [ Homo sapiens (human) ]
Official Symbol IFNGR1
Synonyms IFNGR1; interferon gamma receptor 1; CD119; IFNGR; IMD27A; IMD27B;
Gene ID 3459
mRNA Refseq NM_000416
Protein Refseq NP_000407
MIM 107470
UniProt ID P15260

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNGR1 Products

Required fields are marked with *

My Review for All IFNGR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon