Recombinant Human IFNGR1 Protein, His-tagged
Cat.No. : | IFNGR1-001H |
Product Overview : | Recombinant human IFNGR1(18-245aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
Availability | July 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 18-245 a.a. |
Description : | IFNGR1, also known as interferon gamma receptor 1, is a member of the hematopoietic cytokine receptor superfamily. It is a receptor that binds interferon-γ, the sole member of interferon type II. It induces the rapid dimerization of chains, thereby forming a site that is recognized by the extracellular domain of IFNGR2. It is expressed in a membrane-bound form in many cell types, and is over-expressed in tumour cells. Its signaling promotes autoimmune germinal centers via cell-intrinsic induction of BCL-6. It is crucial for host defence against mycobacterial infections. It is associated with susceptibility to pulmonary tuberculosis (TB). |
Form : | Liquid |
Molecular Mass : | 26.6 kDa |
N-terminal Sequence Analysis : | Glu 18 |
Endotoxin : | < 1.0 EU per 1 μg of protein (determined by LAL method) |
Purity : | > 90% by SDS - PAGE |
Storage : | Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1.0 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
Warning : | For research use only. This product is not intended or approved for human, diagnostics or veterin |
AA Sequence : | EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGHHHHHH |
Gene Name | IFNGR1 interferon gamma receptor 1 [ Homo sapiens (human) ] |
Official Symbol | IFNGR1 |
Synonyms | IFNGR1; interferon gamma receptor 1; CD119; IFNGR; IMD27A; IMD27B; |
Gene ID | 3459 |
mRNA Refseq | NM_000416 |
Protein Refseq | NP_000407 |
MIM | 107470 |
UniProt ID | P15260 |
◆ Recombinant Proteins | ||
Ifngr1-8732R | Recombinant Rat Ifngr1, Fc tagged | +Inquiry |
IFNGR1-7856H | Recombinant Human IFNGR1 protein, hFc-tagged | +Inquiry |
IFNGR1-062H | Recombinant Human IFNGR1 Protein, C-His-tagged | +Inquiry |
IFNGR1-57H | Recombinant Human Interferon Gamma Receptor 1 | +Inquiry |
IFNGR1-1589M | Active Recombinant Mouse IFNGR1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IFNGR1-71H | Active Recombinant Human IFNGR1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNGR1-1175RCL | Recombinant Rat IFNGR1 cell lysate | +Inquiry |
IFNGR1-1775MCL | Recombinant Mouse IFNGR1 cell lysate | +Inquiry |
IFNGR1-1003CCL | Recombinant Cynomolgus IFNGR1 cell lysate | +Inquiry |
IFNGR1-2646HCL | Recombinant Human IFNGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNGR1 Products
Required fields are marked with *
My Review for All IFNGR1 Products
Required fields are marked with *