Recombinant Human IFNGR1 Protein, His-tagged

• Cat.No.: IFNGR1-001H
• Product Overview: Recombinant human IFNGR1(18-245aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 18-245 a.a.
• Description: IFNGR1, also known as interferon gamma receptor 1, is a member of the hematopoietic cytokine receptor superfamily. It is a receptor that binds interferon-γ, the sole member of interferon type II. It induces the rapid dimerization of chains, thereby forming a site that is recognized by the extracellular domain of IFNGR2. It is expressed in a membrane-bound form in many cell types, and is over-expressed in tumour cells. Its signaling promotes autoimmune germinal centers via cell-intrinsic induction of BCL-6. It is crucial for host defence against mycobacterial infections. It is associated with susceptibility to pulmonary tuberculosis (TB).
• Form: Liquid
• Molecular Mass: 26.6 kDa
• N-terminal Sequence Analysis: Glu 18
• Endotoxin: < 1.0 EU per 1 μg of protein (determined by LAL method)
• Purity: > 90% by SDS - PAGE
• Storage: Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1.0 mg/mL (determined by Absorbance at 280nm)
• Storage Buffer: In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
• Warning: For research use only. This product is not intended or approved for human, diagnostics or veterin
• AA Sequence: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGHHHHHH

Gene Information

• Gene Name: IFNGR1 interferon gamma receptor 1 [ Homo sapiens (human) ]
• Official Symbol: IFNGR1
• Synonyms: IFNGR1; interferon gamma receptor 1; CD119; IFNGR; IMD27A; IMD27B
• Gene ID: 3459
• mRNA Refseq: NM_000416
• Protein Refseq: NP_000407
• MIM: 107470
• UniProt ID: P15260