| Species : |
Human |
| Source : |
Insect Cells |
| Tag : |
His |
| Protein Length : |
19-282 a.a. |
| Description : |
OSCAR, also known as osteoclast-associated immunoglobulin-like receptor isoform 6, is an activating receptor expressed by human myeloid cells. It is a receptor for surfactant protein D that activates TNF-α release from human CCR2+ inflammatory monocytes. It is an FcRgamma-associated receptor that is expressed by myeloid cells and is involved in antigen presentation and activation of human dendritic cells. Its expression is detected specifically in preosteoclasts or mature osteoclasts. It is upregulated on monocytes from rheumatoid arthritis (RA) patients with active disease, and these monocytes show an increased proosteoclastogenic potential. |
| Form : |
Liquid |
| Molecular Mass : |
29.2 kDa |
| N-terminal Sequence Analysis : |
Asp 19 |
| Endotoxin : |
< 1.0 EU per 1 μg of protein (determined by LAL method) |
| Purity : |
> 90% by SDS - PAGE |
| Storage : |
Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : |
0.25 mg/mL (determined by Absorbance at 280nm) |
| Storage Buffer : |
In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
| Warning : |
For research use only. This product is not intended or approved for human, diagnostics or veterin |
| AA Sequence : |
DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGSYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGVHHHHHH |