Recombinant Human IFNGR1 Protein, His-tagged

Cat.No. : OSCAR-001H
Product Overview : Recombinant human OSCAR(19-282aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability August 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 19-282 a.a.
Description : OSCAR, also known as osteoclast-associated immunoglobulin-like receptor isoform 6, is an activating receptor expressed by human myeloid cells. It is a receptor for surfactant protein D that activates TNF-α release from human CCR2+ inflammatory monocytes. It is an FcRgamma-associated receptor that is expressed by myeloid cells and is involved in antigen presentation and activation of human dendritic cells. Its expression is detected specifically in preosteoclasts or mature osteoclasts. It is upregulated on monocytes from rheumatoid arthritis (RA) patients with active disease, and these monocytes show an increased proosteoclastogenic potential.
Form : Liquid
Molecular Mass : 29.2 kDa
N-terminal Sequence Analysis : Asp 19
Endotoxin : < 1.0 EU per 1 μg of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin
AA Sequence : DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGSYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGVHHHHHH
Gene Name OSCAR osteoclast associated, immunoglobulin-like receptor [ Homo sapiens (human) ]
Official Symbol OSCAR
Synonyms OSCAR; osteoclast associated, immunoglobulin-like receptor; PIGR3; PIgR-3; osteoclast-associated immunoglobulin-like receptor; osteoclast associated receptor OSCAR-S1; osteoclast associated receptor OSCAR-S2; poly-Ig receptor 3; polymeric immunoglobulin receptor 3
Gene ID 126014
mRNA Refseq NM_001282349
Protein Refseq NP_001269278
MIM 606862
UniProt ID Q8IYS5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All OSCAR Products

Required fields are marked with *

My Review for All OSCAR Products

Required fields are marked with *

0
cart-icon