Recombinant Human OSCAR Protein, His-tagged
| Cat.No. : | OSCAR-002H |
| Product Overview : | Recombinant Human OSCAR Protein, His-tagged,expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 19-229 aa |
| Tag : | C-His |
| Molecular Mass : | 24 kDa |
| AA Sequence : | DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMNFVLYREGVAAPLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEDSGSSDYTRGNHHHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 °C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 1mg/ml by BCA |
| Storage Buffer : | Sterile PBS, pH 7.4 |
| GeneID : | 126014 |
| Gene Name | OSCAR osteoclast associated Ig-like receptor [ Homo sapiens (human) ] |
| Official Symbol | OSCAR |
| Synonyms | PIGR3,PIgR-3,OSCAR |
| MIM | 606862 |
| UniProt ID | Q8IYS5 |
| ◆ Recombinant Proteins | ||
| Oscar-97M | Recombinant Mouse Oscar Protein, His (Fc)-Avi-tagged | +Inquiry |
| OSCAR-002H | Recombinant Human OSCAR Protein, His-tagged | +Inquiry |
| Oscar-001M | Active Recombinant Mouse Oscar Protein, Fc-tagged | +Inquiry |
| OSCAR-1925H | Active Recombinant Human OSCAR protein, His-tagged | +Inquiry |
| OSCAR-22H | Recombinant Human OSCAR protein, hFc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| OSCAR-3528HCL | Recombinant Human OSCAR 293 Cell Lysate | +Inquiry |
| OSCAR-3527HCL | Recombinant Human OSCAR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OSCAR Products
Required fields are marked with *
My Review for All OSCAR Products
Required fields are marked with *
