Recombinant Human IFNL3, His-tagged
| Cat.No. : | IFNL3-112H |
| Product Overview : | Recombinant Human Interleukin-28B/IL-28B is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val22-Val196) of Human IL28B fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 22-196 a.a. |
| AA Sequence : | VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQ VRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRL HHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCVVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| ◆ Recombinant Proteins | ||
| IFNL3-60H | Recombinant Human IFNL3, His-tagged | +Inquiry |
| IFNL3-437H | Recombinant Human IFNL3 Protein, His-tagged | +Inquiry |
| IFNL3-124H | Recombinant Human IFNL3 Protein, His-tagged(C-ter) | +Inquiry |
| Ifnl3-19M | Recombinant Mouse Ifnl3, His and MBP-tagged | +Inquiry |
| IFNL3-405H | Active Recombinant Human IFNL3, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNL3-2059HCL | Recombinant Human IFNL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNL3 Products
Required fields are marked with *
My Review for All IFNL3 Products
Required fields are marked with *
