Recombinant Active Human IFNL3 Protein, His-tagged(C-ter)

Cat.No. : IFNL3-123H
Product Overview : Recombinant Active Human IFNL3 Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq, Jul 2008]
Form : Powder
Bio-activity : Determined by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 5 ng/mL.
AA Sequence : MVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Endotoxin : Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test.
Purity : > 95% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 8.0)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name IFNL3 interferon lambda 3 [ Homo sapiens (human) ]
Official Symbol IFNL3
Synonyms IFNL3; interferon lambda 3; IL28B; IL28C; IL-28B; IL-28C; IFN-lambda-3; IFN-lambda-4; interferon lambda-3; cytokine Zcyto22; interferon, lambda 4; interleukin-28B; interleukin-28C
Gene ID 282617
mRNA Refseq NM_172139
Protein Refseq NP_742151
MIM 607402
UniProt ID Q8IZI9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNL3 Products

Required fields are marked with *

My Review for All IFNL3 Products

Required fields are marked with *

0
cart-icon
0
compare icon