Recombinant Human IFT22 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: IFT22-123H
• Product Overview: RABL5 MS Standard C13 and N15-labeled recombinant protein (NP_073614) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Small GTPase-like component of the intraflagellar transport (IFT) complex B.
• Molecular Mass: 20.8 kDa
• AA Sequence: MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: IFT22 intraflagellar transport 22 [ Homo sapiens (human) ]
• Official Symbol: IFT22
• Synonyms: IFT22; intraflagellar transport 22; RABL5; intraflagellar transport protein 22 homolog; RAB, member RAS oncogene family-like 5; RAB, member of RAS oncogene family-like 5; intraflagellar transport 22 homolog; rab-like protein 5
• Gene ID: 64792
• mRNA Refseq: NM_022777
• Protein Refseq: NP_073614
• UniProt ID: Q9H7X7