Recombinant Human IFT22 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : IFT22-123H
Product Overview : RABL5 MS Standard C13 and N15-labeled recombinant protein (NP_073614) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Small GTPase-like component of the intraflagellar transport (IFT) complex B.
Molecular Mass : 20.8 kDa
AA Sequence : MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name IFT22 intraflagellar transport 22 [ Homo sapiens (human) ]
Official Symbol IFT22
Synonyms IFT22; intraflagellar transport 22; RABL5; intraflagellar transport protein 22 homolog; RAB, member RAS oncogene family-like 5; RAB, member of RAS oncogene family-like 5; intraflagellar transport 22 homolog; rab-like protein 5
Gene ID 64792
mRNA Refseq NM_022777
Protein Refseq NP_073614
UniProt ID Q9H7X7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFT22 Products

Required fields are marked with *

My Review for All IFT22 Products

Required fields are marked with *

0
cart-icon
0
compare icon