Recombinant Human IFT22 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | IFT22-123H |
Product Overview : | RABL5 MS Standard C13 and N15-labeled recombinant protein (NP_073614) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Small GTPase-like component of the intraflagellar transport (IFT) complex B. |
Molecular Mass : | 20.8 kDa |
AA Sequence : | MLKAKILFVGPCESGKTVLANFLTESSDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IFT22 intraflagellar transport 22 [ Homo sapiens (human) ] |
Official Symbol | IFT22 |
Synonyms | IFT22; intraflagellar transport 22; RABL5; intraflagellar transport protein 22 homolog; RAB, member RAS oncogene family-like 5; RAB, member of RAS oncogene family-like 5; intraflagellar transport 22 homolog; rab-like protein 5 |
Gene ID | 64792 |
mRNA Refseq | NM_022777 |
Protein Refseq | NP_073614 |
UniProt ID | Q9H7X7 |
◆ Recombinant Proteins | ||
IFT22-360C | Recombinant Cynomolgus Monkey IFT22 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFT22-123H | Recombinant Human IFT22 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
IFT22-613C | Recombinant Cynomolgus IFT22 Protein, His-tagged | +Inquiry |
IFT22-2605Z | Recombinant Zebrafish IFT22 | +Inquiry |
Ift22-3483M | Recombinant Mouse Ift22 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFT22 Products
Required fields are marked with *
My Review for All IFT22 Products
Required fields are marked with *