Recombinant Human IFT74 Protein, GST-Tagged
Cat.No. : | IFT74-1309H |
Product Overview : | Human CCDC2 partial ORF (NP_079379, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a core intraflagellar transport (IFT) protein which belongs to a multi-protein complex involved in the transport of ciliary proteins along axonemal microtubules. IFT proteins are found at the base of the cilium as well as inside the cilium, where they assemble into long arrays between the ciliary base and tip. This protein, together with intraflagellar transport protein 81, binds and transports tubulin within cilia and is required for ciliogenesis. Naturally occurring mutations in this gene are associated with amyotrophic lateral sclerosis--frontotemporal dementia and Bardet-Biedl Syndrome. [provided by RefSeq, Mar 2017] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MEEVMNGYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQEKQATDDIIKNMSLENQVKYLEMKTTNEKLLQELDTLQQQLDSQNMKKESLEAEI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IFT74 intraflagellar transport 74 homolog (Chlamydomonas) [ Homo sapiens ] |
Official Symbol | IFT74 |
Synonyms | IFT74; intraflagellar transport 74 homolog (Chlamydomonas); CCDC2, coiled coil domain containing 2; intraflagellar transport protein 74 homolog; capillary morphogenesis protein 1; CMG 1; CMG1; FLJ22621; coiled-coil domain containing 2; capillary morphogenesis gene 1 protein; coiled-coil domain-containing protein 2; CCDC2; CMG-1; MGC111562; |
Gene ID | 80173 |
mRNA Refseq | NM_001099222 |
Protein Refseq | NP_001092692 |
MIM | 608040 |
UniProt ID | Q96LB3 |
◆ Recombinant Proteins | ||
IFT74-1393H | Recombinant Human IFT74 Protein, His-tagged | +Inquiry |
IFT74-1309H | Recombinant Human IFT74 Protein, GST-Tagged | +Inquiry |
IFT74-4454M | Recombinant Mouse IFT74 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFT74-4004H | Recombinant Human IFT74 protein, His-tagged | +Inquiry |
IFT74-8056M | Recombinant Mouse IFT74 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFT74 Products
Required fields are marked with *
My Review for All IFT74 Products
Required fields are marked with *
0
Inquiry Basket