Recombinant Human IFT74 Protein, GST-Tagged

Cat.No. : IFT74-1309H
Product Overview : Human CCDC2 partial ORF (NP_079379, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a core intraflagellar transport (IFT) protein which belongs to a multi-protein complex involved in the transport of ciliary proteins along axonemal microtubules. IFT proteins are found at the base of the cilium as well as inside the cilium, where they assemble into long arrays between the ciliary base and tip. This protein, together with intraflagellar transport protein 81, binds and transports tubulin within cilia and is required for ciliogenesis. Naturally occurring mutations in this gene are associated with amyotrophic lateral sclerosis--frontotemporal dementia and Bardet-Biedl Syndrome. [provided by RefSeq, Mar 2017]
Molecular Mass : 36.74 kDa
AA Sequence : MEEVMNGYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQEKQATDDIIKNMSLENQVKYLEMKTTNEKLLQELDTLQQQLDSQNMKKESLEAEI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IFT74 intraflagellar transport 74 homolog (Chlamydomonas) [ Homo sapiens ]
Official Symbol IFT74
Synonyms IFT74; intraflagellar transport 74 homolog (Chlamydomonas); CCDC2, coiled coil domain containing 2; intraflagellar transport protein 74 homolog; capillary morphogenesis protein 1; CMG 1; CMG1; FLJ22621; coiled-coil domain containing 2; capillary morphogenesis gene 1 protein; coiled-coil domain-containing protein 2; CCDC2; CMG-1; MGC111562;
Gene ID 80173
mRNA Refseq NM_001099222
Protein Refseq NP_001092692
MIM 608040
UniProt ID Q96LB3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFT74 Products

Required fields are marked with *

My Review for All IFT74 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon