Recombinant Human IGF1R protein, GST-tagged
| Cat.No. : | IGF1R-5336H |
| Product Overview : | Recombinant Human IGF1R protein(1263-1348 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1263-1348 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | ISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAH |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | IGF1R insulin-like growth factor 1 receptor [ Homo sapiens ] |
| Official Symbol | IGF1R |
| Synonyms | IGF1R; insulin-like growth factor 1 receptor; CD221; IGFIR; IGFR; JTK13; MGC18216; IGF-I receptor; soluble IGF1R variant 1; soluble IGF1R variant 2; insulin-like growth factor I receptor; MGC142170; MGC142172; |
| Gene ID | 3480 |
| mRNA Refseq | NM_000875 |
| Protein Refseq | NP_000866 |
| MIM | 147370 |
| UniProt ID | P08069 |
| ◆ Recombinant Proteins | ||
| IGF1R-0995H | Recombinant Human IGF1R Protein (S982-K1286), His tagged | +Inquiry |
| IGF1R-2660R | Recombinant Rat IGF1R Protein, His (Fc)-Avi-tagged | +Inquiry |
| Igf1r-30R | Recombinant Rat Igf1r protein, His-tagged | +Inquiry |
| IGF1R-330H | Recombinant Human Insulin-like Growth Factor 1 Receptor, His-tagged, Active | +Inquiry |
| IGF1R-4258H | Recombinant Human IGF1R Protein (Met1-Val492), C-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IGF1R-2928HCL | Recombinant Human IGF1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1R Products
Required fields are marked with *
My Review for All IGF1R Products
Required fields are marked with *
