Recombinant Human IGF1R protein, GST-tagged
Cat.No. : | IGF1R-3079H |
Product Overview : | Recombinant Human IGF1R protein(P08069)(763-931aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 763-931aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 46.4 kDa |
AA Sequence : | YNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IGF1R insulin-like growth factor 1 receptor [ Homo sapiens ] |
Official Symbol | IGF1R |
Synonyms | IGF1R; insulin-like growth factor 1 receptor; CD221; IGFIR; IGFR; JTK13; MGC18216; IGF-I receptor; soluble IGF1R variant 1; soluble IGF1R variant 2; insulin-like growth factor I receptor; MGC142170; MGC142172; |
Gene ID | 3480 |
mRNA Refseq | NM_000875 |
Protein Refseq | NP_000866 |
MIM | 147370 |
UniProt ID | P08069 |
◆ Recombinant Proteins | ||
IGF1R-0921H | Recombinant Human IGF1R Protein (Asp741-His935), N-His tagged | +Inquiry |
IGF1R-5027H | Recombinant Human IGF1R protein, His-tagged | +Inquiry |
IGF1R-50HAF647 | Recombinant Human IGF1R Protein, His/GST-tagged, Alexa Fluor 647 conjugated | +Inquiry |
IGF1R-29115TH | Recombinant Human IGF1R, His-tagged | +Inquiry |
IGF1R-3148HF | Recombinant Human IGF1R Protein, His-tagged, FITC conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1R-2928HCL | Recombinant Human IGF1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1R Products
Required fields are marked with *
My Review for All IGF1R Products
Required fields are marked with *