Recombinant Human IGFBP3 protein, His-tagged

Cat.No. : IGFBP3-1410H
Product Overview : Recombinant Human IGFBP3 protein(113-210 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 113-210 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : LCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEY
Gene Name IGFBP3 insulin-like growth factor binding protein 3 [ Homo sapiens ]
Official Symbol IGFBP3
Synonyms IGFBP3; insulin-like growth factor binding protein 3; insulin-like growth factor-binding protein 3; acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP 53; growth hormone dependent binding protein; IBP3; IGF binding protein 3; IBP-3; IGFBP-3; IGF-binding protein 3; growth hormone-dependent binding protein; BP-53;
Gene ID 3486
mRNA Refseq NM_000598
Protein Refseq NP_000589
MIM 146732
UniProt ID P17936

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGFBP3 Products

Required fields are marked with *

My Review for All IGFBP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon