Recombinant Human IGFBP3 protein, His-tagged
| Cat.No. : | IGFBP3-1408H |
| Product Overview : | Recombinant Human IGFBP3 protein(134-291 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 134-291 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | PGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK |
| Gene Name | IGFBP3 insulin-like growth factor binding protein 3 [ Homo sapiens ] |
| Official Symbol | IGFBP3 |
| Synonyms | IGFBP3; insulin-like growth factor binding protein 3; insulin-like growth factor-binding protein 3; acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP 53; growth hormone dependent binding protein; IBP3; IGF binding protein 3; IBP-3; IGFBP-3; IGF-binding protein 3; growth hormone-dependent binding protein; BP-53; |
| Gene ID | 3486 |
| mRNA Refseq | NM_000598 |
| Protein Refseq | NP_000589 |
| MIM | 146732 |
| UniProt ID | P17936 |
| ◆ Recombinant Proteins | ||
| IGFBP3-110I | Active Recombinant Human IGFBP3 Protein (264 aa) | +Inquiry |
| IGFBP3-2678H | Recombinant Human IGFBP3 protein(121-200 aa), C-His-tagged | +Inquiry |
| IGFBP3-1408H | Recombinant Human IGFBP3 protein, His-tagged | +Inquiry |
| IGFBP3-830P | Recombinant Pig IGFBP3 protein, His & T7-tagged | +Inquiry |
| IGFBP3-758H | Recombinant Human IGFBP3 protein(Gly28-Lys291), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IGFBP3-1230CCL | Recombinant Cynomolgus IGFBP3 cell lysate | +Inquiry |
| IGFBP3-2927HCL | Recombinant Human IGFBP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGFBP3 Products
Required fields are marked with *
My Review for All IGFBP3 Products
Required fields are marked with *
