"IKZF1" Related Products

Expand
Expand

Recombinant Human IKZF1 protein, T7/His-tagged

Cat.No.: IKZF1-182H
Product Overview: Recombinant human IKAROS cDNA (519aa, Isoform_1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSS KSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDIC GIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSV GKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGTLYPVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVA KRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPM YQLHKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAPHA RNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGY HSQDRYEFSSHITRGEHRFHMS
Purity: >90% by SDS-PAGE.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: IKZF1 IKAROS family zinc finger 1 (Ikaros) [ Homo sapiens ]
Official Symbol: IKZF1
Synonyms: IKZF1; IKAROS family zinc finger 1 (Ikaros); hIk 1; Hs.54452; IKAROS; LyF 1; CLL-associated antigen KW-6; IK1; LYF1; hIk-1; PRO0758; ZNFN1A1;
Gene ID: 10320
mRNA Refseq: NM_001220765
Protein Refseq: NP_001207694
MIM: 603023
UniProt ID: Q13422
Chromosome Location: 7pter-7qter
Pathway: Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem;
Function: DNA binding; metal ion binding; nucleic acid binding; protein heterodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.