Recombinant Human IKZF1 protein, T7/His-tagged
Cat.No. : | IKZF1-182H |
Product Overview : | Recombinant human IKAROS cDNA (519aa, Isoform_1) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSS KSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDIC GIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSV GKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGTLYPVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVA KRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPM YQLHKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAPHA RNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCGY HSQDRYEFSSHITRGEHRFHMS |
Purity : | >90% by SDS-PAGE. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | IKZF1 IKAROS family zinc finger 1 (Ikaros) [ Homo sapiens ] |
Official Symbol | IKZF1 |
Synonyms | IKZF1; IKAROS family zinc finger 1 (Ikaros); hIk 1; Hs.54452; IKAROS; LyF 1; CLL-associated antigen KW-6; IK1; LYF1; hIk-1; PRO0758; ZNFN1A1; |
Gene ID | 10320 |
mRNA Refseq | NM_001220765 |
Protein Refseq | NP_001207694 |
MIM | 603023 |
UniProt ID | Q13422 |
Chromosome Location | 7pter-7qter |
Pathway | Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; |
Function | DNA binding; metal ion binding; nucleic acid binding; protein heterodimerization activity; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
IKZF1-9822HFL | Recombinant Full Length Human IKZF1 protein, Flag-tagged | +Inquiry |
IKZF1-6645C | Recombinant Chicken IKZF1 | +Inquiry |
Ikzf1-3498M | Recombinant Mouse Ikzf1 Protein, Myc/DDK-tagged | +Inquiry |
IKZF1-125H | Recombinant Human IKZF1 protein, MYC/DDK-tagged | +Inquiry |
IKZF1-8622Z | Recombinant Zebrafish IKZF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IKZF1-850HCL | Recombinant Human IKZF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IKZF1 Products
Required fields are marked with *
My Review for All IKZF1 Products
Required fields are marked with *