Recombinant Human IL10 protein(19-178 aa), N-MBP & C-His-tagged
Cat.No. : | IL10-2697H |
Product Overview : | Recombinant Human IL10 protein(P22301)(19-178 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His&MBP |
Protein Length : | 19-178 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
Gene Name | IL10 interleukin 10 [ Homo sapiens ] |
Official Symbol | IL10 |
Synonyms | IL10; interleukin 10; interleukin-10; CSIF; cytokine synthesis inhibitory factor; IL 10; IL10A; T cell growth inhibitory factor; TGIF; T-cell growth inhibitory factor; GVHDS; IL-10; MGC126450; MGC126451; |
Gene ID | 3586 |
mRNA Refseq | NM_000572 |
Protein Refseq | NP_000563 |
MIM | 124092 |
UniProt ID | P22301 |
◆ Recombinant Proteins | ||
IL10-79P | Recombinant Porcine Interleukin 10 | +Inquiry |
IL10-001R | Active Recombinant Rat IL10, HIgG1 Fc-tagged | +Inquiry |
IL10-33O | Recombinant Ovine IL10 Protein | +Inquiry |
IL10-22R | Recombinant Rhesus macaque IL10 Protein, His-tagged | +Inquiry |
IL10-134H | Recombinant Active Human IL10 Protein, His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *