Recombinant Human IL10RB Protein, Fc-tagged
Cat.No. : | IL10RB-952H |
Product Overview : | Recombinant Human IL10RB fused with Fc tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Description : | The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21. |
Form : | Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4 |
Molecular Mass : | 50.6kD |
AA Sequence : | MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | IL10RB interleukin 10 receptor, beta [ Homo sapiens ] |
Official Symbol | IL10RB |
Synonyms | IL10RB; interleukin 10 receptor, beta; CRFB4, D21S58, D21S66; interleukin-10 receptor subunit beta; CDW210B; CRF2 4; IL 10R2; IL-10RB; IL-10R subunit 2; IL-10R subunit beta; IL-10 receptor subunit beta; cytokine receptor class-II CRF2-4; interleukin-10 receptor subunit 2; cytokine receptor class-II member 4; cytokine receptor family 2 member 4; cytokine receptor family II, member 4; CRFB4; CRF2-4; D21S58; D21S66; IL-10R2; |
Gene ID | 3588 |
mRNA Refseq | NM_000628 |
Protein Refseq | NP_000619 |
MIM | 123889 |
UniProt ID | Q08334 |
◆ Recombinant Proteins | ||
IL10RB-1211H | Recombinant Human IL10RB Protein (Leu87-Ala243), N-His tagged | +Inquiry |
IL10RB-4431H | Recombinant Human IL10RB Protein, His (Fc)-Avi tagged, Biotinylated | +Inquiry |
Il10rb-5181M | Recombinant Mouse Il10rb protein(Met1-Ser222), His-tagged | +Inquiry |
IL10RB-202H | Recombinant Human IL10RB Protein, Met20-Ser220, C-Fc tagged | +Inquiry |
IL10RB-952H | Recombinant Human IL10RB Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10RB-1371RCL | Recombinant Rat IL10RB cell lysate | +Inquiry |
IL10RB-1795MCL | Recombinant Mouse IL10RB cell lysate | +Inquiry |
IL10RB-2677HCL | Recombinant Human IL10RB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL10RB Products
Required fields are marked with *
My Review for All IL10RB Products
Required fields are marked with *
0
Inquiry Basket