Recombinant Human IL10RB Protein, Fc-tagged

Cat.No. : IL10RB-952H
Product Overview : Recombinant Human IL10RB fused with Fc tag at C-terminal was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Description : The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21.
Form : Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass : 50.6kD
AA Sequence : MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK*
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name IL10RB interleukin 10 receptor, beta [ Homo sapiens ]
Official Symbol IL10RB
Synonyms IL10RB; interleukin 10 receptor, beta; CRFB4, D21S58, D21S66; interleukin-10 receptor subunit beta; CDW210B; CRF2 4; IL 10R2; IL-10RB; IL-10R subunit 2; IL-10R subunit beta; IL-10 receptor subunit beta; cytokine receptor class-II CRF2-4; interleukin-10 receptor subunit 2; cytokine receptor class-II member 4; cytokine receptor family 2 member 4; cytokine receptor family II, member 4; CRFB4; CRF2-4; D21S58; D21S66; IL-10R2;
Gene ID 3588
mRNA Refseq NM_000628
Protein Refseq NP_000619
MIM 123889
UniProt ID Q08334

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL10RB Products

Required fields are marked with *

My Review for All IL10RB Products

Required fields are marked with *

0
cart-icon
0
compare icon