Recombinant Human IL12 Protein

• Cat.No.: IL12-158H
• Product Overview: Recombinant Human IL12(Arg23-Ser219&Ile23-Ser328) was produced in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Non
• Protein Length: Arg23-Ser219&Ile23-Ser328
• Description: IL-12 is involved in the differentiation of naive T cells into Th1 cells. It is known as a T cell-stimulating factor, which can stimulate the growth and function of T cells. It stimulates the production of interferon-gamma (IFN-γ) and tumor necrosis factor-alpha (TNF-α) from T cells and natural killer (NK) cells, and reduces IL-4 mediated suppression of IFN-γ. T cells that produce IL-12 have a coreceptor, CD30, which is associated with IL-12 activity.IL-12 plays an important role in the activities of natural killer cells and T lymphocytes. IL-12 mediates enhancement of the cytotoxic activity of NK cells and CD8+ cytotoxic T lymphocytes.
• Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
• AA sequence: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLP LELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQ IFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLN AS&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGD AGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTIS TDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDA VHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQG KSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100 μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.