Recombinant Human IL12A protein
Cat.No. : | IL12A-26973TH |
Product Overview : | Recombinant Human IL12A protein was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Protein Length : | 525 |
Description : | Interleukin-12 (IL-12), also known as NKSF or CLMF, is a pleiotropic cytokine originally identified in the medium of activated human B lymphoblastoid cell lines. The p40 subunit of IL-12 has been shown to have extensive amino acid sequence homology to the extracellular domain of the human IL-6 receptor while the p35 subunit shows distant but significant sequence similarity to IL-6, G-CSF, and chicken MGF. These observations have led to the suggestion that IL-12 might have evolved from a cytokine/soluble receptor complex. Human and murine IL-12 share 70 % and 60 % amino acid sequence homology in their p40 and p35 subunits, respectively. IL-12 apparently shows species specificity with human IL-12 reportedly showing minimal activity in the murine system. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using PHA-activated human T lymphoblasts is less than 0.05 ng/ml, corresponding to a specific activity of > 2.0 × 10⁷ IU/mg. |
Molecular Mass : | Approximately 75 kDa, consisting of a 306 amino acid residue p40 subunit and a 197 amino acid residue p35 subunit. |
AA Sequence : | p35Subunit:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASp40Subunit:IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS |
Endotoxin : | Less than 1 EU/µg of rHuIL-12 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL12A |
Official Symbol | IL12A |
Synonyms | IL12A; interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35); NKSF1; interleukin-12 subunit alpha; CLMF; cytotoxic lymphocyte maturation factor 1; p35; IL 12; subunit p35; IL 12A; IL35 subunit; interleukin 12; interleukin 12 alpha chain; natural killer cell stimulatory factor 1; 35 kD subunit; NF cell stimulatory factor chain 1; NFSK; CLMF p35; IL-12 subunit p35; IL-12, subunit p35; interleukin 12, p35; interleukin-12 alpha chain; NK cell stimulatory factor chain 1; cytotoxic lymphocyte maturation factor 1, p35; cytotoxic lymphocyte maturation factor 35 kDa subunit; natural killer cell stimulatory factor 1, 35 kD subunit; P35; IL-12A; |
Gene ID | 3592 |
mRNA Refseq | NM_000882 |
Protein Refseq | NP_000873 |
MIM | 161560 |
UniProt ID | P29459 |
◆ Recombinant Proteins | ||
IL12A-132H | Recombinant Human interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35), His-tagged | +Inquiry |
IL12A-0255H | Recombinant Human IL12A protein, Fc-tagged | +Inquiry |
IL12A-4327HG | Active Recombinant Human IL12A protein | +Inquiry |
IL12A-165H | Rcombinant Human IL12A, His-Fc-tagged | +Inquiry |
IL12A-9483R | Recombinant Rhesus IL12A protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12A-2435HCL | Recombinant Human IL12A cell lysate | +Inquiry |
IL12A-001CCL | Recombinant Cynomolgus IL12A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12A Products
Required fields are marked with *
My Review for All IL12A Products
Required fields are marked with *
0
Inquiry Basket