Recombinant Human IL12RB1 protein, hFc-Avi-tagged

Cat.No. : IL12RB1-6332H
Product Overview : Recombinant Human IL12RB1 protein(P42701)(24-545aa), fused with C-hFc-Avi tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Avi&Fc
Protein Length : 24-545a.a.
Tag : hFc-Avi
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 85.5 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSD
Gene Name IL12RB1 interleukin 12 receptor, beta 1 [ Homo sapiens ]
Official Symbol IL12RB1
Synonyms IL12RB1; interleukin 12 receptor, beta 1; IL12RB; interleukin-12 receptor subunit beta-1; CD212; IL-12RB1; IL-12R-beta-1; IL-12R subunit beta-1; IL-12 receptor beta component; IL-12 receptor subunit beta-1; interleukin-12 receptor beta-1 chain; IL-12R-BETA1; MGC34454;
Gene ID 3594
mRNA Refseq NM_005535
Protein Refseq NP_005526
MIM 601604
UniProt ID P42701

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL12RB1 Products

Required fields are marked with *

My Review for All IL12RB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon