Recombinant Human IL12RB1 protein, hFc-Avi-tagged
Cat.No. : | IL12RB1-6332H |
Product Overview : | Recombinant Human IL12RB1 protein(P42701)(24-545aa), fused with C-hFc-Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Avi&Fc |
Protein Length : | 24-545a.a. |
Tag : | hFc-Avi |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 85.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSD |
Gene Name | IL12RB1 interleukin 12 receptor, beta 1 [ Homo sapiens ] |
Official Symbol | IL12RB1 |
Synonyms | IL12RB1; interleukin 12 receptor, beta 1; IL12RB; interleukin-12 receptor subunit beta-1; CD212; IL-12RB1; IL-12R-beta-1; IL-12R subunit beta-1; IL-12 receptor beta component; IL-12 receptor subunit beta-1; interleukin-12 receptor beta-1 chain; IL-12R-BETA1; MGC34454; |
Gene ID | 3594 |
mRNA Refseq | NM_005535 |
Protein Refseq | NP_005526 |
MIM | 601604 |
UniProt ID | P42701 |
◆ Recombinant Proteins | ||
IL12RB1-0229H | Active Recombinant Human IL12RB1 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
IL12RB1-0225M | Active Recombinant Mouse IL12RB1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL12RB1-139H | Recombinant Human interleukin 12 receptor, beta 1 Protein, His tagged | +Inquiry |
IL12RB1-6332H | Recombinant Human IL12RB1 protein, hFc-Avi-tagged | +Inquiry |
IL12RB1-0226H | Active Recombinant Human IL12RB1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12RB1-2188HCL | Recombinant Human IL12RB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL12RB1 Products
Required fields are marked with *
My Review for All IL12RB1 Products
Required fields are marked with *