Recombinant Human IL12RB1 protein, hFc-Avi-tagged

• Cat.No.: IL12RB1-6332H
• Product Overview: Recombinant Human IL12RB1 protein(P42701)(24-545aa), fused with C-hFc-Avi tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Avi&Fc
• Protein Length: 24-545a.a.
• Tag: hFc-Avi
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 85.5 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFASAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSD

Gene Information

• Gene Name: IL12RB1 interleukin 12 receptor, beta 1 [ Homo sapiens ]
• Official Symbol: IL12RB1
• Synonyms: IL12RB1; interleukin 12 receptor, beta 1; IL12RB; interleukin-12 receptor subunit beta-1; CD212; IL-12RB1; IL-12R-beta-1; IL-12R subunit beta-1; IL-12 receptor beta component; IL-12 receptor subunit beta-1; interleukin-12 receptor beta-1 chain; IL-12R-BETA1; MGC34454
• Gene ID: 3594
• mRNA Refseq: NM_005535
• Protein Refseq: NP_005526
• MIM: 601604
• UniProt ID: P42701