Recombinant Human IL13 protein

Cat.No. : IL13-165H
Product Overview : Recombinant Human IL13 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 112
Description : Human Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 5. IL-13 is a 132 amino acid protein containing a proposed 20 amino acid signal peptide, and shares approximately 30% amino acid sequence homology to human IL-4. Additionally, the two cytokines exhibit overlapping biological activities. Human IL-13 is produced by activated Th0, Th1-like Th2-like and CD8 T cells. Similarly to IL-4, IL-13 has multiple effects on the differentiation and functions of monocytes/macrophages. IL-13 can suppress the cytotoxic functions of monocytes/macrophages.IL-13 variant is a natural variant of IL-13 and has a Q instead of R112 of wild type, which associated with increased risk for asthma development and at homozygosity associated with higher levels of serum total IgE in some allergic rhinitis patients.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.2, with 5 % trehalose.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 12.3 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids, with a substitution of Q for R at position 112 compared with the wild type IL-13.
AA Sequence : GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Endotoxin : Less than 1 EU/µg of rHuIL-13, Variant as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL13
Official Symbol IL13
Synonyms IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13;
Gene ID 3596
mRNA Refseq NM_002188
Protein Refseq NP_002179
MIM 147683
UniProt ID P35225

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL13 Products

Required fields are marked with *

My Review for All IL13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon