Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
112 |
Description : |
Human Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 5. IL-13 is a 132 amino acid protein containing a proposed 20 amino acid signal peptide, and shares approximately 30% amino acid sequence homology to human IL-4. Additionally, the two cytokines exhibit overlapping biological activities. Human IL-13 is produced by activated Th0, Th1-like Th2-like and CD8 T cells. Similarly to IL-4, IL-13 has multiple effects on the differentiation and functions of monocytes/macrophages. IL-13 can suppress the cytotoxic functions of monocytes/macrophages.IL-13 variant is a natural variant of IL-13 and has a Q instead of R112 of wild type, which associated with increased risk for asthma development and at homozygosity associated with higher levels of serum total IgE in some allergic rhinitis patients. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.2, with 5 % trehalose. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : |
Approximately 12.3 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids, with a substitution of Q for R at position 112 compared with the wild type IL-13. |
AA Sequence : |
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN |
Endotoxin : |
Less than 1 EU/µg of rHuIL-13, Variant as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |