Recombinant Human IL13 protein
Cat.No. : | IL13-165H |
Product Overview : | Recombinant Human IL13 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 112 |
Description : | Human Interleukin-13 (IL-13) is expressed by the IL13 gene located on the chromosome 5. IL-13 is a 132 amino acid protein containing a proposed 20 amino acid signal peptide, and shares approximately 30% amino acid sequence homology to human IL-4. Additionally, the two cytokines exhibit overlapping biological activities. Human IL-13 is produced by activated Th0, Th1-like Th2-like and CD8 T cells. Similarly to IL-4, IL-13 has multiple effects on the differentiation and functions of monocytes/macrophages. IL-13 can suppress the cytotoxic functions of monocytes/macrophages.IL-13 variant is a natural variant of IL-13 and has a Q instead of R112 of wild type, which associated with increased risk for asthma development and at homozygosity associated with higher levels of serum total IgE in some allergic rhinitis patients. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.2, with 5 % trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
Molecular Mass : | Approximately 12.3 kDa, a single non-glycosylated polypeptide chain containing 112 amino acids, with a substitution of Q for R at position 112 compared with the wild type IL-13. |
AA Sequence : | GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN |
Endotoxin : | Less than 1 EU/µg of rHuIL-13, Variant as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL13 |
Official Symbol | IL13 |
Synonyms | IL13; interleukin 13; interleukin-13; allergic rhinitis; ALRH; BHR1; Bronchial hyperresponsiveness 1 (bronchial asthma); IL 13; MGC116786; MGC116788; MGC116789; P600; Bronchial hyperresponsiveness-1 (bronchial asthma); IL-13; |
Gene ID | 3596 |
mRNA Refseq | NM_002188 |
Protein Refseq | NP_002179 |
MIM | 147683 |
UniProt ID | P35225 |
◆ Recombinant Proteins | ||
Il13-089M | Recombinant Mouse Il13 Protein | +Inquiry |
IL13-2231R | Recombinant Rhesus monkey IL13 Protein, His-tagged | +Inquiry |
IL13-373C | Recombinant Cynomolgus IL13 protein(Ser21-Asn132), His-tagged | +Inquiry |
IL13-58C | Recombinant Chicken IL-13 | +Inquiry |
IL13-146R | Recombinant Rhesus Interleukin 13 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL13-001HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1336MCL | Recombinant Mouse IL13 cell lysate | +Inquiry |
IL13-2922HCL | Recombinant Human IL13 cell lysate | +Inquiry |
IL13-1894CCL | Recombinant Cynomolgus IL13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL13 Products
Required fields are marked with *
My Review for All IL13 Products
Required fields are marked with *
0
Inquiry Basket