Recombinant Human IL15 protein, His-tagged
Cat.No. : | IL15-4663H |
Product Overview : | Recombinant Human IL15 protein(P40933)(49-162 aa), fused with N-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 49-162 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 14.3 kDa |
AASequence : | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | IL15 interleukin 15 [ Homo sapiens ] |
Official Symbol | IL15 |
Synonyms | IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15; |
Gene ID | 3600 |
mRNA Refseq | NM_000585 |
Protein Refseq | NP_000576 |
MIM | 600554 |
UniProt ID | P40933 |
◆ Recombinant Proteins | ||
IL15-145H | Recombinant Active Human IL15 Protein, His-tagged(N-ter) | +Inquiry |
Il15-7234M | Active Recombinant Mouse Il15 Protein, His-tagged | +Inquiry |
IL15-6361H | Recombinant Human IL15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IL15-270H | Recombinant Human IL15, StrepII-tagged | +Inquiry |
IL15-063H | Active Recombinant Human IL15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL15-5248HCL | Recombinant Human IL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL15 Products
Required fields are marked with *
My Review for All IL15 Products
Required fields are marked with *