Recombinant Human IL15 protein, His-tagged

• Cat.No.: IL15-4663H
• Product Overview: Recombinant Human IL15 protein(P40933)(49-162 aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 49-162 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 14.3 kDa
• AASequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: IL15 interleukin 15 [ Homo sapiens ]
• Official Symbol: IL15
• Synonyms: IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15
• Gene ID: 3600
• mRNA Refseq: NM_000585
• Protein Refseq: NP_000576
• MIM: 600554
• UniProt ID: P40933