Recombinant Human IL15RA protein, His&Myc-tagged
Cat.No. : | IL15RA-4379H |
Product Overview : | Recombinant Human IL15RA protein(Q13261)(31-205aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 31-205aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 23.4 kDa |
AA Sequence : | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTAKNWELTASASHQPPGVYPQGHSDTT |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IL15RA interleukin 15 receptor, alpha [ Homo sapiens ] |
Official Symbol | IL15RA |
Synonyms | IL15RA; interleukin 15 receptor, alpha; interleukin-15 receptor subunit alpha; CD215; IL 15RA; MGC104179; |
Gene ID | 3601 |
mRNA Refseq | NM_001243539 |
Protein Refseq | NP_001230468 |
MIM | 601070 |
UniProt ID | Q13261 |
◆ Recombinant Proteins | ||
IL15RA-0267H | Active Recombinant Human IL15RA protein, Fc-tagged, FITC-Labeled | +Inquiry |
Il15ra-1663R | Recombinant Rat Il15ra Protein, His&GST-tagged | +Inquiry |
IL15RA-1653H | Recombinant Human Interleukin 15 Receptor, Alpha, Fc-His | +Inquiry |
IL15RA-4310H | Recombinant Human IL15RA Protein (Met1-Thr205), C-Fc tagged | +Inquiry |
IL15RA-273H | Recombinant Human IL15RA protein, His-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
IL15RA-73M | Active Recombinant Mouse IL15RA Protein, His-tagged | +Inquiry |
IL15RA-49H | Active Recombinant Human IL15RA Homodimer Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL15RA-5246HCL | Recombinant Human IL15RA Overexpression Lysate(Ile31-Thr205) | +Inquiry |
IL15RA-5247HCL | Recombinant Human IL15RA Overexpression Lysate(Ile31-Asp96&Asn49-Ser162) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL15RA Products
Required fields are marked with *
My Review for All IL15RA Products
Required fields are marked with *