Recombinant Human IL17F protein

Cat.No. : IL17F-36H
Product Overview : Recombinant Human IL17F protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 134
Description : Human Interleukin-17F (IL-17F) is encoded by the IL17F gene located on the chromosome 6 and belongs to the IL-17 family which contains IL-17A, IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17F that shares 50 % homologous of crystal structure to IL-17A and is expressed by activated T cells, has the functions of stimulating production of other cytokines (such as IL-6, IL-8 and granulocyte colony-stimulating factor) and proliferation of PBMC and T-cell, regulating cartilage matrix turnover, and inhibiting angiogenesis.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 20 ng/ml, corresponding to a specific activity of > 5.0 × 10⁴ IU/mg.
Molecular Mass : Approximately 30.1 kDa, a disulfide-linked homodimer of two 134 amino acid polypeptide chains.
AA Sequence : MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
Endotoxin : Less than 1 EU/µg of rHuIL-17F as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 6 mM HCl to a concentration of 0.1mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL17F
Official Symbol IL17F
Synonyms IL17F; interleukin 17F; interleukin-17F; IL 17F; ML 1; ML1; IL-24; cytokine ML-1; mutant IL-17F; interleukin-24; ML-1; CANDF6; IL-17F;
Gene ID 112744
mRNA Refseq NM_052872
Protein Refseq NP_443104
MIM 606496
UniProt ID Q96PD4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL17F Products

Required fields are marked with *

My Review for All IL17F Products

Required fields are marked with *

0
cart-icon