Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
134 |
Description : |
Human Interleukin-17F (IL-17F) is encoded by the IL17F gene located on the chromosome 6 and belongs to the IL-17 family which contains IL-17A, IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17F that shares 50 % homologous of crystal structure to IL-17A and is expressed by activated T cells, has the functions of stimulating production of other cytokines (such as IL-6, IL-8 and granulocyte colony-stimulating factor) and proliferation of PBMC and T-cell, regulating cartilage matrix turnover, and inhibiting angiogenesis. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by inducing IL-6 secretion of murine NIH/3T3 cells is less than 20 ng/ml, corresponding to a specific activity of > 5.0 × 10⁴ IU/mg. |
Molecular Mass : |
Approximately 30.1 kDa, a disulfide-linked homodimer of two 134 amino acid polypeptide chains. |
AA Sequence : |
MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ |
Endotoxin : |
Less than 1 EU/µg of rHuIL-17F as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 6 mM HCl to a concentration of 0.1mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |