Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
153 |
Description : |
Human Interleukin-19 (IL-19) is encoded by the IL19 gene, which is located on the chromosome 1. The protein belongs to the IL-10 family that includes IL-10, IL-20, IL-22, IL-24, and IL-26. As a monomer made of seven amphipathic helices, IL-19 has a helical bundle and shares the same cell surface receptor (IL-20R) with IL-20 and IL-24. It may play some important roles in inflammatory responses because it up-regulates IL-6 and TNF-alpha and induces apoptosis. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human IL-20Rα and human IL-20Rβ co-transfected murine BaF3 pro-B cells is less than 1.5 ng/ml, corresponding to a specific activity of > 6.7 × 10⁵ IU/mg. |
Molecular Mass : |
Approximately 17.9 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids. |
AA Sequence : |
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA |
Endotoxin : |
Less than 1 EU/µg of rHuIL-19 as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 100 mM HAC to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |