Recombinant Human IL1A protein, GST-tagged

Cat.No. : IL1A-14167H
Product Overview : Recombinant Human IL1A protein (113-271 aa) fused to GST-tag and was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 159
Description : The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease.
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5% trehalose and 5% mannitol are added as protectants before lyophilization.
Molecular Mass : 44 kDa
AA Sequence : SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Samples are stable for up to twelve months from date of receipt at -20 centigrade to -80 centigrade
Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Gene Name IL1A
Official Symbol IL1A
Synonyms IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha
Gene ID 3552
mRNA Refseq NM_000575.5
Protein Refseq NP_000566.3
MIM 147760
UniProt ID P01583

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1A Products

Required fields are marked with *

My Review for All IL1A Products

Required fields are marked with *

0
cart-icon