Recombinant Human IL1A protein, GST-tagged
| Cat.No. : | IL1A-14167H |
| Product Overview : | Recombinant Human IL1A protein (113-271 aa) fused to GST-tag and was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 159 |
| Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5% trehalose and 5% mannitol are added as protectants before lyophilization. |
| Molecular Mass : | 44 kDa |
| AA Sequence : | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Samples are stable for up to twelve months from date of receipt at -20 centigrade to -80 centigrade Store it under sterile conditions at -20 centigrade to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | IL1A |
| Official Symbol | IL1A |
| Synonyms | IL1; IL-1A; IL1F1; IL1-ALPHA; IL-1 alpha |
| Gene ID | 3552 |
| mRNA Refseq | NM_000575.5 |
| Protein Refseq | NP_000566.3 |
| MIM | 147760 |
| UniProt ID | P01583 |
| ◆ Recombinant Proteins | ||
| IL1A-2687R | Recombinant Rat IL1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| IL1A-2238R | Recombinant Rhesus monkey IL1A Protein, His-tagged | +Inquiry |
| IL1A-14166H | Recombinant Human IL1A, GST-tagged | +Inquiry |
| IL1A-3982C | Recombinant Cynomolgus monkey IL1A protein(113-271aa), His-Myc-tagged | +Inquiry |
| IL1A-1018H | Active Recombinant Human IL1A protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1A Products
Required fields are marked with *
My Review for All IL1A Products
Required fields are marked with *



