Recombinant Human IL1A protein, His-tagged
Cat.No. : | IL1A-3095H |
Product Overview : | Recombinant Human IL1A protein(P01583)(113-271aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 113-271aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22 kDa |
AA Sequence : | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IL1A interleukin 1, alpha [ Homo sapiens ] |
Official Symbol | IL1A |
Synonyms | IL1A; interleukin 1, alpha; IL1; interleukin-1 alpha; hematopoietin 1; IL 1A; IL1 ALPHA; IL1F1; preinterleukin 1 alpha; pro interleukin 1 alpha; IL-1 alpha; hematopoietin-1; pro-interleukin-1-alpha; IL-1A; IL1-ALPHA; |
Gene ID | 3552 |
mRNA Refseq | NM_000575 |
Protein Refseq | NP_000566 |
MIM | 147760 |
UniProt ID | P01583 |
◆ Recombinant Proteins | ||
Il1a-92R | Recombinant Rat Interleukin 1 Alpha | +Inquiry |
IL1A-577R | Recombinant Rhesus Macaque IL1A Protein (113-271 aa), His-SUMO-tagged | +Inquiry |
IL1A-620D | Recombinant Dog IL1A protein, His-tagged | +Inquiry |
IL1A-3032R | Recombinant Rat IL1A Protein | +Inquiry |
IL1A-622C | Recombinant Caprine (Goat) IL1A protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IL1A-049H | Active Recombinant Human IL1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1A Products
Required fields are marked with *
My Review for All IL1A Products
Required fields are marked with *