Recombinant Human IL1A protein, His-tagged
| Cat.No. : | IL1A-3095H |
| Product Overview : | Recombinant Human IL1A protein(P01583)(113-271aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 113-271aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 22 kDa |
| AA Sequence : | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | IL1A interleukin 1, alpha [ Homo sapiens ] |
| Official Symbol | IL1A |
| Synonyms | IL1A; interleukin 1, alpha; IL1; interleukin-1 alpha; hematopoietin 1; IL 1A; IL1 ALPHA; IL1F1; preinterleukin 1 alpha; pro interleukin 1 alpha; IL-1 alpha; hematopoietin-1; pro-interleukin-1-alpha; IL-1A; IL1-ALPHA; |
| Gene ID | 3552 |
| mRNA Refseq | NM_000575 |
| Protein Refseq | NP_000566 |
| MIM | 147760 |
| UniProt ID | P01583 |
| ◆ Recombinant Proteins | ||
| Il1a-158M | Recombinant Active Mouse IL1A Protein, His-tagged(C-ter) | +Inquiry |
| IL1A-631R | Recombinant Rabbit IL1A protein, His-tagged | +Inquiry |
| IL1A-622C | Active Recombinant Goat IL1A protein, His-tagged | +Inquiry |
| IL1A-16458H | Recombinant Human IL1A protein, GST-tagged | +Inquiry |
| IL1A-02H | Active Recombinant Human IL1A Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1A Products
Required fields are marked with *
My Review for All IL1A Products
Required fields are marked with *



