Recombinant Human IL1A protein, GST-tagged
Cat.No. : | IL1A-16458H |
Product Overview : | Recombinant Human IL1A protein(113-271 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Tag : | GST |
Protein Length : | 113-271 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
Gene Name | IL1A interleukin 1, alpha [ Homo sapiens ] |
Official Symbol | IL1A |
Synonyms | IL1A; interleukin 1, alpha; IL1; interleukin-1 alpha; hematopoietin 1; IL 1A; IL1 ALPHA; IL1F1; preinterleukin 1 alpha; pro interleukin 1 alpha; IL-1 alpha; hematopoietin-1; pro-interleukin-1-alpha; IL-1A; IL1-ALPHA; |
Gene ID | 3552 |
mRNA Refseq | NM_000575 |
Protein Refseq | NP_000566 |
MIM | 147760 |
UniProt ID | P01583 |
◆ Recombinant Proteins | ||
Il1a-627M | Recombinant Mouse Il1a protein, His & T7-tagged | +Inquiry |
IL1A-501H | Active Recombinant Human IL1A protein | +Inquiry |
IL1A-5444R | Recombinant Rhesus macaque IL1A protein, His-tagged | +Inquiry |
Il1a-624G | Recombinant Guinea pig Il1a protein, His & S-tagged | +Inquiry |
IL1A-83R | Recombinant Rhesus IL1A protein | +Inquiry |
◆ Native Proteins | ||
IL1A-049H | Active Recombinant Human IL1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1A-2911HCL | Recombinant Human IL1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1A Products
Required fields are marked with *
My Review for All IL1A Products
Required fields are marked with *