Recombinant Human IL1A protein, GST-tagged

Cat.No. : IL1A-16458H
Product Overview : Recombinant Human IL1A protein(113-271 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Tag : GST
Protein Length : 113-271 aa
Tag : N-GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Gene Name IL1A interleukin 1, alpha [ Homo sapiens ]
Official Symbol IL1A
Synonyms IL1A; interleukin 1, alpha; IL1; interleukin-1 alpha; hematopoietin 1; IL 1A; IL1 ALPHA; IL1F1; preinterleukin 1 alpha; pro interleukin 1 alpha; IL-1 alpha; hematopoietin-1; pro-interleukin-1-alpha; IL-1A; IL1-ALPHA;
Gene ID 3552
mRNA Refseq NM_000575
Protein Refseq NP_000566
MIM 147760
UniProt ID P01583

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1A Products

Required fields are marked with *

My Review for All IL1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon