Recombinant Human IL1B protein, His-SUMO-tagged
| Cat.No. : | IL1B-3096H |
| Product Overview : | Recombinant Human IL1B protein(P01584)(117-269aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 117-269aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.4 kDa |
| AA Sequence : | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | IL1B interleukin 1, beta [ Homo sapiens ] |
| Official Symbol | IL1B |
| Synonyms | IL1B; interleukin 1, beta; interleukin-1 beta; IL 1B; IL1 BETA; IL1F2; IL-1 beta; catabolin; preinterleukin 1 beta; pro-interleukin-1-beta; IL-1; IL1-BETA; |
| Gene ID | 3553 |
| mRNA Refseq | NM_000576 |
| Protein Refseq | NP_000567 |
| MIM | 147720 |
| UniProt ID | P01584 |
| ◆ Recombinant Proteins | ||
| IL1B-321H | Recombinant Human IL1B, His-tagged | +Inquiry |
| Il1b-040E | Active Recombinant Mouse Il1b (118-269aa), Met tagged | +Inquiry |
| IL1B-920C | Active Recombinant Canine IL1B Protein (Ala115-Ser266) | +Inquiry |
| IL1B-162H | Recombinant Active Human IL1B Protein, His-tagged(C-ter) | +Inquiry |
| IL1B-40H | Recombinant Human IL1B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1B Products
Required fields are marked with *
My Review for All IL1B Products
Required fields are marked with *
