Recombinant Human IL1F10 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IL1F10-4727H |
Product Overview : | IL1F10 MS Standard C13 and N15-labeled recombinant protein (NP_775184) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. This cytokine is thought to participate in a network of interleukin 1 family members to regulate adapted and innate immune responses. Two alternatively spliced transcript variants encoding the same protein have been reported. |
Molecular Mass : | 17 kDa |
AA Sequence : | MCSLPMARYYIIKYADQKALYTRDGQLLVGDPVADNCCAEKICTLPNRGLDRTKVPIFLGIQGGSRCLACVETEEGPSLQLEDVNIEELYKGGEEATRFTFFQSSSGSAFRLEAAAWPGWFLCGPAEPQQPVQLTKESEPSARTKFYFEQSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IL1F10 interleukin 1 family member 10 [ Homo sapiens (human) ] |
Official Symbol | IL1F10 |
Synonyms | IL1F10; interleukin 1 family, member 10 (theta); interleukin-1 family member 10; FIL1 theta; FKSG75; IL 1F10; IL 1HY2; IL1 theta; interleukin 1 receptor antagonist FKSG75; MGC11983; MGC119832; MGC119833; FIL1 theta; IL-1 theta; interleukin-1 HY2; interleukin-1 theta; IL-1F10 (canonical form IL-1F10a); interleukin-1 receptor antagonist FKSG75; interleukin-1 receptor antagonist-like FIL1 theta; IL-1HY2; IL1-theta; FIL1-theta; MGC119831; |
Gene ID | 84639 |
mRNA Refseq | NM_173161 |
Protein Refseq | NP_775184 |
MIM | 173470 |
UniProt ID | Q8WWZ1 |
◆ Recombinant Proteins | ||
IL1F10-109H | Recombinant Human IL1F10 Protein | +Inquiry |
IL1F10-187H | Recombinant Human IL1F10 protein(Met1-Trp152), His-tagged | +Inquiry |
IL1F10-669H | Recombinant Human IL1F10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IL1F10-15884H | Recombinant Human IL1F10, His-tagged | +Inquiry |
Il1f10-3504M | Recombinant Mouse Il1f10 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1F10-5241HCL | Recombinant Human IL1F10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1F10 Products
Required fields are marked with *
My Review for All IL1F10 Products
Required fields are marked with *