Recombinant Human IL1R1 Protein, C-His-tagged
Cat.No. : | IL1R1-064H |
Product Overview : | Recombinant Human IL1R1 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Three structurally related ligands for IL-1Rs have been described. Theseinclude two agonists, IL-1α and IL-1β, and a specific receptor antagonist, IL-1Rα. Among the activities regulated by IL-1 are fever, acute phase responses, degradation of connective tissue and immunostimulatory activities. The IL-1Rα molecule also binds specifically to IL-1Rs, but fails to initiate intracellular responses. Two distinct IL-1Rs have been identified, each of which belongs to the Ig superfamily and is widely expressed in a broad range of cells and tissues. Although many cell types co-express type I and type II receptors, there is no evidence that these constitute subunits of a single complex. The type II receptor has a short 29 amino acid cytoplasmic domain that does not seem sufficient for signaling while in fact there is considerable evidence arguing that IL-1 signals exclusively through the type I IL-1R. |
Molecular Mass : | ~35 kDa |
AA Sequence : | LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQK |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | IL1R1 interleukin 1 receptor, type I [ Homo sapiens (human) ] |
Official Symbol | IL1R1 |
Synonyms | IL1R1; interleukin 1 receptor, type I; IL1R, IL1RA; interleukin-1 receptor type 1; CD121A; D2S1473; IL-1R-1; IL-1RT1; IL-1RT-1; antigen CD121a; interleukin receptor 1; interleukin-1 receptor alpha; interleukin-1 receptor type I; CD121 antigen-like family member A; interleukin 1 receptor alpha, type I; P80; IL1R; IL1RA; IL-1R-alpha; |
Gene ID | 3554 |
mRNA Refseq | NM_000877 |
Protein Refseq | NP_000868 |
MIM | 147810 |
UniProt ID | P14778 |
◆ Recombinant Proteins | ||
Il1r1-5188M | Recombinant Mouse Il1r1 protein, His-tagged | +Inquiry |
IL1R1-3012H | Active Recombinant Human IL1R1, HIgG1 Fc-tagged | +Inquiry |
IL1R1-1214H | Recombinant Human IL1R1 Protein (Asp21-Ile109), N-GST tagged | +Inquiry |
Il1r1-5652M | Active Recombinant Mouse Interleukin 1 Receptor, Type I, His-tagged | +Inquiry |
Il1r1-5653M | Active Recombinant Mouse Interleukin 1 Receptor, Type I, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1R1-945CCL | Recombinant Cynomolgus IL1R1 cell lysate | +Inquiry |
IL1R1-1787MCL | Recombinant Mouse IL1R1 cell lysate | +Inquiry |
IL1R1-1935RCL | Recombinant Rat IL1R1 cell lysate | +Inquiry |
IL1R1-1120HCL | Recombinant Human IL1R1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1R1 Products
Required fields are marked with *
My Review for All IL1R1 Products
Required fields are marked with *
0
Inquiry Basket