Recombinant Human IL1RL1 protein, T7/His-tagged

Cat.No. : IL1RL1-144H
Product Overview : Recombinant extracellular domain of human IL1RL1 cDNA (19 – 328aa, Isoform-II, derived from BC030975) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 19-328 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFGSKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQER NRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTID LYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFP VIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVL RIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHS
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro IL1RL1 mediated T cell activation in IL-33 regulatory pathway study with this protein either as soluble factor or as coating matrix protein.2. May be used for mapping IL1RL1 protein-protein interaction.3. Potential biomarker protein for diagnostic applications, such as preeclampsia or GVHD et al.4. As immunogen for specific antibody production.
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name IL1RL1 interleukin 1 receptor-like 1 [ Homo sapiens ]
Official Symbol IL1RL1
Synonyms IL1RL1; interleukin 1 receptor-like 1; interleukin-1 receptor-like 1; DER4; FIT 1; homolog of mouse growth stimulation expressed; IL33R; ST2; ST2L; ST2V; T1; growth stimulation-expressed; interleukin 1 receptor-related protein; homolog of mouse growth stimulation-expressed; FIT-1; MGC32623;
Gene ID 9173
mRNA Refseq NM_003856
Protein Refseq NP_003847
MIM 601203
UniProt ID Q01638
Chromosome Location 2q12
Function cytokine receptor activity; interleukin-1 receptor activity; interleukin-33 binding; protein binding; receptor activity; receptor signaling protein activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1RL1 Products

Required fields are marked with *

My Review for All IL1RL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon