Recombinant Human IL1RL1 protein, T7/His-tagged
| Cat.No. : | IL1RL1-144H | 
| Product Overview : | Recombinant extracellular domain of human IL1RL1 cDNA (19 – 328aa, Isoform-II, derived from BC030975) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&T7 | 
| Protein Length : | 19-328 a.a. | 
| Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. | 
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQER NRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTID LYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFP VIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVL RIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHS | 
| Purity : | >90% by SDS-PAGE | 
| Applications : | 1. May be used for in vitro IL1RL1 mediated T cell activation in IL-33 regulatory pathway study with this protein either as soluble factor or as coating matrix protein.2. May be used for mapping IL1RL1 protein-protein interaction.3. Potential biomarker protein for diagnostic applications, such as preeclampsia or GVHD et al.4. As immunogen for specific antibody production. | 
| Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. | 
| Gene Name | IL1RL1 interleukin 1 receptor-like 1 [ Homo sapiens ] | 
| Official Symbol | IL1RL1 | 
| Synonyms | IL1RL1; interleukin 1 receptor-like 1; interleukin-1 receptor-like 1; DER4; FIT 1; homolog of mouse growth stimulation expressed; IL33R; ST2; ST2L; ST2V; T1; growth stimulation-expressed; interleukin 1 receptor-related protein; homolog of mouse growth stimulation-expressed; FIT-1; MGC32623; | 
| Gene ID | 9173 | 
| mRNA Refseq | NM_003856 | 
| Protein Refseq | NP_003847 | 
| MIM | 601203 | 
| UniProt ID | Q01638 | 
| Chromosome Location | 2q12 | 
| Function | cytokine receptor activity; interleukin-1 receptor activity; interleukin-33 binding; protein binding; receptor activity; receptor signaling protein activity; | 
| ◆ Recombinant Proteins | ||
| IL1RL1-30316TH | Recombinant Human IL1RL1, His-tagged | +Inquiry | 
| IL1RL1-501H | Recombinant Human IL1RL1, FLAG-tagged | +Inquiry | 
| IL1RL1-6811M | Recombinant Mouse IL1RL1 Protein (Lys19-Phe328), C-His tagged | +Inquiry | 
| IL1RL1-773H | Recombinant Human IL1RL1 protein, Fc-tagged | +Inquiry | 
| IL1RL1-3035R | Recombinant Rat IL1RL1 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| IL1RL1-2481HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry | 
| IL1RL1-1883HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry | 
| IL1RL1-001MCL | Recombinant Mouse IL1RL1 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1RL1 Products
Required fields are marked with *
My Review for All IL1RL1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            