"IL1RL1" Related Products

Expand
Expand
Expand

Recombinant Human IL1RL1 protein, T7/His-tagged

Cat.No.: IL1RL1-144H
Product Overview: Recombinant extracellular domain of human IL1RL1 cDNA (19 – 328aa, Isoform-II, derived from BC030975) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGSKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQER NRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTID LYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFP VIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVL RIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHS
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro IL1RL1 mediated T cell activation in IL-33 regulatory pathway study with this protein either as soluble factor or as coating matrix protein.2. May be used for mapping IL1RL1 protein-protein interaction.3. Potential biomarker protein for diagnostic applications, such as preeclampsia or GVHD et al.4. As immunogen for specific antibody production.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: IL1RL1 interleukin 1 receptor-like 1 [ Homo sapiens ]
Official Symbol: IL1RL1
Synonyms: IL1RL1; interleukin 1 receptor-like 1; interleukin-1 receptor-like 1; DER4; FIT 1; homolog of mouse growth stimulation expressed; IL33R; ST2; ST2L; ST2V; T1; growth stimulation-expressed; interleukin 1 receptor-related protein; homolog of mouse growth stimulation-expressed; FIT-1; MGC32623;
Gene ID: 9173
mRNA Refseq: NM_003856
Protein Refseq: NP_003847
MIM: 601203
UniProt ID: Q01638
Chromosome Location: 2q12
Function: cytokine receptor activity; interleukin-1 receptor activity; interleukin-33 binding; protein binding; receptor activity; receptor signaling protein activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.