Recombinant Human IL1RL1 protein, T7/His-tagged
Cat.No. : | IL1RL1-144H |
Product Overview : | Recombinant extracellular domain of human IL1RL1 cDNA (19 – 328aa, Isoform-II, derived from BC030975) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 19-328 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFGSKFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQER NRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTID LYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFP VIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVL RIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHS |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro IL1RL1 mediated T cell activation in IL-33 regulatory pathway study with this protein either as soluble factor or as coating matrix protein.2. May be used for mapping IL1RL1 protein-protein interaction.3. Potential biomarker protein for diagnostic applications, such as preeclampsia or GVHD et al.4. As immunogen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | IL1RL1 interleukin 1 receptor-like 1 [ Homo sapiens ] |
Official Symbol | IL1RL1 |
Synonyms | IL1RL1; interleukin 1 receptor-like 1; interleukin-1 receptor-like 1; DER4; FIT 1; homolog of mouse growth stimulation expressed; IL33R; ST2; ST2L; ST2V; T1; growth stimulation-expressed; interleukin 1 receptor-related protein; homolog of mouse growth stimulation-expressed; FIT-1; MGC32623; |
Gene ID | 9173 |
mRNA Refseq | NM_003856 |
Protein Refseq | NP_003847 |
MIM | 601203 |
UniProt ID | Q01638 |
Chromosome Location | 2q12 |
Function | cytokine receptor activity; interleukin-1 receptor activity; interleukin-33 binding; protein binding; receptor activity; receptor signaling protein activity; |
◆ Recombinant Proteins | ||
IL1RL1-2690R | Recombinant Rat IL1RL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL1RL1-1009H | Active Recombinant Human ST2 Protein | +Inquiry |
IL1RL1-775H | Recombinant Human IL1RL1 protein(Met1-Phe328) | +Inquiry |
IL1RL1-144H | Recombinant Human IL1RL1 protein, T7/His-tagged | +Inquiry |
IL1RL1-396H | Recombinant Human Interleukin 1 Receptor-Like 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RL1-001MCL | Recombinant Mouse IL1RL1 cell lysate | +Inquiry |
IL1RL1-1883HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry |
IL1RL1-2481HCL | Recombinant Human IL1RL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL1RL1 Products
Required fields are marked with *
My Review for All IL1RL1 Products
Required fields are marked with *
0
Inquiry Basket