Recombinant Human IL1RN Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : IL1RN-3350H
Product Overview : IL1RN MS Standard C13 and N15-labeled recombinant protein (NP_776214) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.
Molecular Mass : 17.1 kDa
AA Sequence : MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name IL1RN interleukin 1 receptor antagonist [ Homo sapiens (human) ]
Official Symbol IL1RN
Synonyms IL1RN; interleukin 1 receptor antagonist; interleukin-1 receptor antagonist protein; ICIL 1RA; IL 1RN; IL1F3; IL1RA; interleukin 1 receptor antagonist protein; intracellular interleukin 1 receptor antagonist; IRAP; MGC10430; IL1 inhibitor; IL1RN (IL1F3); type II interleukin-1 receptor antagonist; intracellular IL-1 receptor antagonist type II; intracellular interleukin-1 receptor antagonist (icIL-1ra); DIRA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA;
Gene ID 3557
mRNA Refseq NM_173842
Protein Refseq NP_776214
MIM 147679
UniProt ID P18510

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1RN Products

Required fields are marked with *

My Review for All IL1RN Products

Required fields are marked with *

0
cart-icon
0
compare icon