Recombinant Human IL21R Protein, His-tagged
Cat.No. : | IL21R-325H |
Product Overview : | Recombinant human IL21R protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 538 |
Description : | The protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2, 4, 7, 9, and 15. This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants have been described. |
Form : | Lyophilized |
Molecular Mass : | 25.8 kDa |
AA Sequence : | MPRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLLLLLLVIVFIPAFWSLKTHPLWRLWKKIWAVPSPERFFMPLYKGCSGDFKKWVGAPFTGSSLELGPWSPEVPSTLEVYSCHPPRSPAKRLQLTELQEPAELVESDGVPKPSFWPTAQNSGGSAYSEERDRPYGLVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLDAGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGSPLAGLDMDTFDSGFVGSDCSSPVECDFTSPGDEGPPRSYLRQWVVIPPPLSSPGPQAS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IL21R interleukin 21 receptor [ Homo sapiens (human) ] |
Official Symbol | IL21R |
Synonyms | IL21R; interleukin 21 receptor; interleukin-21 receptor; CD360; IL-21R; IL-21 receptor; novel interleukin receptor; NILR; MGC10967; |
Gene ID | 50615 |
mRNA Refseq | NM_021798 |
Protein Refseq | NP_068570 |
MIM | 605383 |
UniProt ID | Q9HBE5 |
◆ Recombinant Proteins | ||
Il21r-02M | Active Recombinant Mouse Il21r Protein, hIgG/His-tagged | +Inquiry |
Il21r-1627H | Recombinant Human Il21r protein, hFc-tagged | +Inquiry |
Il21r-448M | Recombinant Mouse Il21r protein(Met1-Pro236), hFc-tagged | +Inquiry |
Il21r-10582M | Recombinant Mouse Il21r Protein, His (Fc)-Avi-tagged | +Inquiry |
IL21R-1464C | Recombinant Cynomolgus IL21R protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21R-1442RCL | Recombinant Rat IL21R cell lysate | +Inquiry |
IL21R-2019HCL | Recombinant Human IL21R cell lysate | +Inquiry |
IL21R-001CCL | Recombinant Cynomolgus IL21R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL21R Products
Required fields are marked with *
My Review for All IL21R Products
Required fields are marked with *