Recombinant Human IL21R protein, T7/His-tagged
Cat.No. : | IL21R-99H |
Product Overview : | Recombinant human CD360 cDNA (20 – 232 aa), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 20-232 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSC SLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRS DYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWS EWSDPVIFQTQSEELKE |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro non-glycosylated CD360 protein mediated T cell activations regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD360 protein-protein interaction assay.3. As enzymeatic substrate for vasious proteases.4. As antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | IL21R interleukin 21 receptor [ Homo sapiens ] |
Official Symbol | IL21R |
Synonyms | IL21R; interleukin 21 receptor; interleukin-21 receptor; CD360; IL-21R; IL-21 receptor; novel interleukin receptor; NILR; MGC10967; |
Gene ID | 50615 |
mRNA Refseq | NM_021798 |
Protein Refseq | NP_068570 |
MIM | 605383 |
UniProt ID | Q9HBE5 |
Chromosome Location | 16p11 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function | interleukin-21 receptor activity; receptor activity; |
◆ Recombinant Proteins | ||
Il21r-1763M | Recombinant Mouse Interleukin 21 Receptor | +Inquiry |
IL21R-944R | Active Recombinant Rat IL21R protein, mFc-tagged | +Inquiry |
Il21r-448M | Recombinant Mouse Il21r protein(Met1-Pro236), hFc-tagged | +Inquiry |
IL21R-512M | Active Recombinant Mouse IL21R, MIgG2a Fc-tagged, mutant | +Inquiry |
IL21R-273H | Recombinant Human IL21R protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21R-2019HCL | Recombinant Human IL21R cell lysate | +Inquiry |
IL21R-1442RCL | Recombinant Rat IL21R cell lysate | +Inquiry |
IL21R-001CCL | Recombinant Cynomolgus IL21R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL21R Products
Required fields are marked with *
My Review for All IL21R Products
Required fields are marked with *