Recombinant Human IL21R protein, T7/His-tagged

Cat.No. : IL21R-99H
Product Overview : Recombinant human CD360 cDNA (20 – 232 aa), fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 20-232 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKDEATSC SLHRSAHNATHATYTCHMDVFHFMADDIFSVNITDQSGNYSQECGSFLLAESIKPAPPFNVTVTFSGQYNISWRS DYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDSRSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWS EWSDPVIFQTQSEELKE
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro non-glycosylated CD360 protein mediated T cell activations regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD360 protein-protein interaction assay.3. As enzymeatic substrate for vasious proteases.4. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name IL21R interleukin 21 receptor [ Homo sapiens ]
Official Symbol IL21R
Synonyms IL21R; interleukin 21 receptor; interleukin-21 receptor; CD360; IL-21R; IL-21 receptor; novel interleukin receptor; NILR; MGC10967;
Gene ID 50615
mRNA Refseq NM_021798
Protein Refseq NP_068570
MIM 605383
UniProt ID Q9HBE5
Chromosome Location 16p11
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;
Function interleukin-21 receptor activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL21R Products

Required fields are marked with *

My Review for All IL21R Products

Required fields are marked with *

0
cart-icon
0
compare icon