Active Recombinant Mouse Il21r Protein, hIgG/His-tagged

Cat.No. : Il21r-02M
Product Overview : Recombinant mouse IL21R (20-237aa), fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Availability October 23, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc&His
Protein Length : 20-237aa
Description : Enables cytokine receptor activity. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in lung; mandible; and orbito-sphenoid. Human ortholog(s) of this gene implicated in B-cell lymphoma (multiple); Crohn's disease; autoimmune disease (multiple); human immunodeficiency virus infectious disease; and immunodeficiency 56. Orthologous to human IL21R (interleukin 21 receptor).
Form : Liquid
Bio-activity : Measured by its ability to inhibit IFN-g secretion using NK-92 human natural killer cells. The ED50 range ≤ 4 μg/mL with mouse IL-2.
Molecular Mass : 52 kDa (457aa)
AA Sequence : CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDPH
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Il21r interleukin 21 receptor [ Mus musculus (house mouse) ]
Official Symbol Il21r
Synonyms Il21r; interleukin 21 receptor; NILR; interleukin-21 receptor; IL-21 receptor; IL-21R; LR-beta; NR8; lymphocyte receptor beta; novel cytokine receptor 8; novel interleukin receptor
Gene ID 60504
mRNA Refseq NM_021887
Protein Refseq NP_068687.1
UniProt ID Q9JHX3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il21r Products

Required fields are marked with *

My Review for All Il21r Products

Required fields are marked with *

0
cart-icon
0
compare icon