Active Recombinant Mouse Il21r Protein, hIgG/His-tagged
| Cat.No. : | Il21r-02M |
| Product Overview : | Recombinant mouse IL21R (20-237aa), fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | Fc&His |
| Protein Length : | 20-237aa |
| Description : | Enables cytokine receptor activity. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in lung; mandible; and orbito-sphenoid. Human ortholog(s) of this gene implicated in B-cell lymphoma (multiple); Crohn's disease; autoimmune disease (multiple); human immunodeficiency virus infectious disease; and immunodeficiency 56. Orthologous to human IL21R (interleukin 21 receptor). |
| Form : | Liquid |
| Bio-activity : | Measured by its ability to inhibit IFN-g secretion using NK-92 human natural killer cells. The ED50 range ≤ 4 μg/mL with mouse IL-2. |
| Molecular Mass : | 52 kDa (457aa) |
| AA Sequence : | CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDPH |
| Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE, Bioactivity |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 1 mg/mL (determined by Absorbance at 280nm) |
| Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Gene Name | Il21r interleukin 21 receptor [ Mus musculus (house mouse) ] |
| Official Symbol | Il21r |
| Synonyms | Il21r; interleukin 21 receptor; NILR; interleukin-21 receptor; IL-21 receptor; IL-21R; LR-beta; NR8; lymphocyte receptor beta; novel cytokine receptor 8; novel interleukin receptor |
| Gene ID | 60504 |
| mRNA Refseq | NM_021887 |
| Protein Refseq | NP_068687.1 |
| UniProt ID | Q9JHX3 |
| ◆ Recombinant Proteins | ||
| IL21R-944R | Active Recombinant Rat IL21R protein, mFc-tagged | +Inquiry |
| Il21r-7452R | Active Recombinant Rat Il21r protein, His-tagged | +Inquiry |
| IL21R-341M | Active Recombinant Mouse IL21R, Fc-tagged | +Inquiry |
| Il21r-1625M | Active Recombinant Mouse Il21r protein, His-Avi-tagged, Biotinylated | +Inquiry |
| IL21R-4441H | Recombinant Human IL21R Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL21R-001CCL | Recombinant Cynomolgus IL21R cell lysate | +Inquiry |
| IL21R-2019HCL | Recombinant Human IL21R cell lysate | +Inquiry |
| IL21R-1442RCL | Recombinant Rat IL21R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il21r Products
Required fields are marked with *
My Review for All Il21r Products
Required fields are marked with *



