Active Recombinant Mouse Il21r Protein, hIgG/His-tagged
Cat.No. : | Il21r-02M |
Product Overview : | Recombinant mouse IL21R (20-237aa), fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques. |
Availability | July 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Fc&His |
Protein Length : | 20-237aa |
Description : | Enables cytokine receptor activity. Predicted to be located in membrane. Predicted to be integral component of membrane. Is expressed in lung; mandible; and orbito-sphenoid. Human ortholog(s) of this gene implicated in B-cell lymphoma (multiple); Crohn's disease; autoimmune disease (multiple); human immunodeficiency virus infectious disease; and immunodeficiency 56. Orthologous to human IL21R (interleukin 21 receptor). |
Form : | Liquid |
Bio-activity : | Measured by its ability to inhibit IFN-g secretion using NK-92 human natural killer cells. The ED50 range ≤ 4 μg/mL with mouse IL-2. |
Molecular Mass : | 52 kDa (457aa) |
AA Sequence : | CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDPH |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | Il21r interleukin 21 receptor [ Mus musculus (house mouse) ] |
Official Symbol | Il21r |
Synonyms | Il21r; interleukin 21 receptor; NILR; interleukin-21 receptor; IL-21 receptor; IL-21R; LR-beta; NR8; lymphocyte receptor beta; novel cytokine receptor 8; novel interleukin receptor |
Gene ID | 60504 |
mRNA Refseq | NM_021887 |
Protein Refseq | NP_068687.1 |
UniProt ID | Q9JHX3 |
◆ Recombinant Proteins | ||
Il21r-1626C | Active Recombinant Cynomolgus Il21r protein, Fc-tagged | +Inquiry |
IL21R-4795H | Recombinant Human IL21R protein, His-tagged | +Inquiry |
IL21R-944R | Active Recombinant Rat IL21R protein, mFc-tagged | +Inquiry |
Il21r-1627H | Recombinant Human Il21r protein, hFc-tagged | +Inquiry |
IL21R-4794H | Recombinant Human IL21R Protein (Met1-Pro236), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL21R-2019HCL | Recombinant Human IL21R cell lysate | +Inquiry |
IL21R-1442RCL | Recombinant Rat IL21R cell lysate | +Inquiry |
IL21R-001CCL | Recombinant Cynomolgus IL21R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il21r Products
Required fields are marked with *
My Review for All Il21r Products
Required fields are marked with *