Recombinant Human IL24 Protein, His-tagged
Cat.No. : | IL24-934H |
Product Overview : | Recombinant Human IL24, transcript variant 1, fused with His tag at C-terminal was expressed in CHO cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | His |
Description : | This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Molecular Mass : | 18.9 kDa |
AA Sequence : | QEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKLHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | IL24 interleukin 24 [ Homo sapiens ] |
Official Symbol | IL24 |
Synonyms | IL24; interleukin 24; ST16; interleukin-24; C49A; FISP; IL 4 induced secreted protein; IL 24; IL10B; mda 7; melanoma differentiation association protein 7; Mob 5; suppression of tumorigenicity 16 (melanoma differentiation); melanocyte-associated Mda-7; IL-4-induced secreted protein; melanoma differentiation-associated gene 7 protein; MDA7; MOB5; |
Gene ID | 11009 |
mRNA Refseq | NM_001185156 |
Protein Refseq | NP_001172085 |
MIM | 604136 |
UniProt ID | Q13007 |
◆ Recombinant Proteins | ||
IL24-2978H | Recombinant Human IL24 protein, His-tagged | +Inquiry |
Il24-194R | Recombinant Rat Il24 Protein, His/GST-tagged | +Inquiry |
IL24-14189H | Recombinant Human IL24, GST-tagged | +Inquiry |
Il24-01M | Active Recombinant Mouse Il24 Protein, His-Tagged | +Inquiry |
IL24-553H | Recombinant Human IL24 Protein (Met1-Leu207), MIgG1 Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL24-1922HCL | Recombinant Human IL24 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL24 Products
Required fields are marked with *
My Review for All IL24 Products
Required fields are marked with *
0
Inquiry Basket