Recombinant Human IL29 Protein
Cat.No. : | IL29-513H |
Product Overview : | Recombinant human IL29 protein |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Protein Length : | 200 |
Description : | This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). |
Form : | Lyophilized |
AA Sequence : | MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | IL29 interleukin 29 (interferon, lambda 1) [ Homo sapiens (human) ] |
Official Symbol | IL29 |
Synonyms | IL29; interleukin 29 (interferon, lambda 1); interleukin 29; interleukin-29; IFNL1; IL 29; IFN-lambda-1; cytokine Zcyto21; interferon lambda-1; interferon-lambda-1; interferon, lambda 1; IL-29; |
Gene ID | 282618 |
mRNA Refseq | NM_172140 |
Protein Refseq | NP_742152 |
MIM | 607403 |
UniProt ID | Q8IU54 |
◆ Cell & Tissue Lysates | ||
IL29-5228HCL | Recombinant Human IL29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL29 Products
Required fields are marked with *
My Review for All IL29 Products
Required fields are marked with *
0
Inquiry Basket