Recombinant Human IL2RG Protein, GST-tagged

Cat.No. : IL2RG-14197H
Product Overview : Recombinant Human IL2RG Protein with a GST tag was expressed in E. coli.
Availability October 14, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Description : The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder.
Molecular Mass : ~ 66.2KDa, reducing conditions
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Purity : >90%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.1 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in PBS, pH 8.0
Gene Name IL2RG interleukin 2 receptor subunit gamma [ Homo sapiens (human) ]
Official Symbol IL2RG
Synonyms IL2RG; interleukin 2 receptor subunit gamma; P64; CIDX; IMD4; CD132; SCIDX; IL-2RG; SCIDX1; cytokine receptor common subunit gamma; CD132 antigen; IL-2 receptor subunit gamma; IL-2R subunit gamma; common cytokine receptor gamma chain; gammaC; interleukin 2 receptor, gamma; nonfunctional common cytokine receptor gamma chain
Gene ID 3561
mRNA Refseq NM_000206
Protein Refseq NP_000197
MIM 308380
UniProt ID P31785

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL2RG Products

Required fields are marked with *

My Review for All IL2RG Products

Required fields are marked with *

0
cart-icon
0
compare icon