Recombinant Human IL2RG Protein, GST-tagged
Cat.No. : | IL2RG-14197H |
Product Overview : | Recombinant Human IL2RG Protein with a GST tag was expressed in E. coli. |
Availability | October 14, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Description : | The protein encoded by this gene is an important signaling component of many interleukin receptors, including those of interleukin -2, -4, -7 and -21, and is thus referred to as the common gamma chain. Mutations in this gene cause X-linked severe combined immunodeficiency (XSCID), as well as X-linked combined immunodeficiency (XCID), a less severe immunodeficiency disorder. |
Molecular Mass : | ~ 66.2KDa, reducing conditions |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET |
Purity : | >90%, by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.1 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in PBS, pH 8.0 |
Gene Name | IL2RG interleukin 2 receptor subunit gamma [ Homo sapiens (human) ] |
Official Symbol | IL2RG |
Synonyms | IL2RG; interleukin 2 receptor subunit gamma; P64; CIDX; IMD4; CD132; SCIDX; IL-2RG; SCIDX1; cytokine receptor common subunit gamma; CD132 antigen; IL-2 receptor subunit gamma; IL-2R subunit gamma; common cytokine receptor gamma chain; gammaC; interleukin 2 receptor, gamma; nonfunctional common cytokine receptor gamma chain |
Gene ID | 3561 |
mRNA Refseq | NM_000206 |
Protein Refseq | NP_000197 |
MIM | 308380 |
UniProt ID | P31785 |
◆ Recombinant Proteins | ||
IL2RG-5194H | Recombinant Human IL2RG Protein | +Inquiry |
IL2RG-29663TH | Recombinant Human IL2RG, Fc-tagged | +Inquiry |
IL2RG-0170C | Recombinant Cynomolgus IL2RG protein, His-tagged | +Inquiry |
IL2RG-7289H | Recombinant Human IL2RG protein, Fc-tagged | +Inquiry |
IL2RG-5193H | Recombinant Human IL2RG Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2RG-2908MCL | Recombinant Mouse IL2RG cell lysate | +Inquiry |
IL2RG-1476RCL | Recombinant Rat IL2RG cell lysate | +Inquiry |
IL2RG-502HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
IL2RG-1481HCL | Recombinant Human IL2RG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL2RG Products
Required fields are marked with *
My Review for All IL2RG Products
Required fields are marked with *