Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
154 |
Description : |
Interleukin-36 receptor antagonist (IL-36RA) is a secreted protein which belongs to the interleukin 1 cytokine family (IL-1 family) and it is predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. IL-36RA has been reported to antagonize the biological activity of IL-36α (IL-1F6), IL-36β (IL-1F8), and IL-36γ (IL-1F9). Furthermore, it could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1). In addition, The receptor for IL-36RA has not been positively identified. Indirect evidence suggests it is IL-1Rrp2. Recombinant human IL-36 RA contains 154 amino acid residues and it shares 91 % a.a. sequence identity with murine IL-36RA. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-36 beta induced IL-8 secretion by human preadipocytes is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg in the presence of 20 ng/ml of recombinant human IL-36 beta. |
Molecular Mass : |
Approximately 16.8 kDa, a single non-glycosylated polypeptide chain containing 154 amino acids. |
AA Sequence : |
VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
Endotoxin : |
Less than 1 EU/µg of rHuIL-36RA as determined by LAL method. |
Purity : |
>95% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |