Recombinant Human IL36RN protein
Cat.No. : | IL36RN-512H |
Product Overview : | Recombinant Human IL36RN protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 154 |
Description : | Interleukin-36 receptor antagonist (IL-36RA) is a secreted protein which belongs to the interleukin 1 cytokine family (IL-1 family) and it is predominantly expressed in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. IL-36RA has been reported to antagonize the biological activity of IL-36α (IL-1F6), IL-36β (IL-1F8), and IL-36γ (IL-1F9). Furthermore, it could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1). In addition, The receptor for IL-36RA has not been positively identified. Indirect evidence suggests it is IL-1Rrp2. Recombinant human IL-36 RA contains 154 amino acid residues and it shares 91 % a.a. sequence identity with murine IL-36RA. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-36 beta induced IL-8 secretion by human preadipocytes is less than 1.0 μg/ml, corresponding to a specific activity of > 1000 IU/mg in the presence of 20 ng/ml of recombinant human IL-36 beta. |
Molecular Mass : | Approximately 16.8 kDa, a single non-glycosylated polypeptide chain containing 154 amino acids. |
AA Sequence : | VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD |
Endotoxin : | Less than 1 EU/µg of rHuIL-36RA as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | IL36RN |
Official Symbol | IL36RN |
Synonyms | IL36RN; interleukin 36 receptor antagonist; IL1F5, interleukin 1 family, member 5 (delta); interleukin-36 receptor antagonist protein; family of interleukin 1 delta; FIL1; FIL1(DELTA); FIL1D; IL 1 related protein 3; IL 1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; interleukin 1 HY1; interleukin 1 receptor antagonist homolog 1; MGC29840; IL-1ra homolog 1; interleukin-1 HY1; IL-1 related protein 3; interleukin-1-like protein 1; family of interleukin 1-delta; IL1F5 (Canonical product IL-1F5a); interleukin 1 family, member 5 (delta); interleukin-1 receptor antagonist homolog 1; IL-1F5 (IL-1HY1, FIL1-delta, IL-1RP3, IL-1L1, IL-1-delta); IL1F5; PSORP; |
Gene ID | 26525 |
mRNA Refseq | NM_012275 |
Protein Refseq | NP_036407 |
MIM | 605507 |
UniProt ID | Q9UBH0 |
◆ Recombinant Proteins | ||
IL36RN-152H | Recombinant Human IL36RN Protein, His-tagged | +Inquiry |
IL36RN-3478H | Recombinant Human IL36RN protein, His-tagged | +Inquiry |
IL36RN-151H | Recombinant Human IL36RN Protein, His-tagged | +Inquiry |
IL1F5-316H | Active Recombinant Human IL1F5 protein | +Inquiry |
IL36RN-3479H | Recombinant Human IL36RN Protein (Lys12-Phe151), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36RN-5240HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
IL36RN-5239HCL | Recombinant Human IL1F5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL36RN Products
Required fields are marked with *
My Review for All IL36RN Products
Required fields are marked with *
0
Inquiry Basket