Recombinant Human IL4R Protein, GST-tagged
Cat.No. : | IL4R-5179H |
Product Overview : | Human IL4R partial ORF ( NP_000409, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by an alternate splice variant or by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Two transcript variants encoding different isoforms, a membrane-bound and a soluble form, have been found for this gene. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IL4R interleukin 4 receptor [ Homo sapiens ] |
Official Symbol | IL4R |
Synonyms | IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; CD124; IL-4 receptor subunit alpha; interleukin-4 receptor alpha chain; IL4RA; IL-4RA; |
Gene ID | 3566 |
mRNA Refseq | NM_000418 |
Protein Refseq | NP_000409 |
MIM | 147781 |
UniProt ID | P24394 |
◆ Recombinant Proteins | ||
IL4R-2388P | Recombinant Pig IL4R Protein (33-240 aa), His-tagged | +Inquiry |
IL4R-587HB | Recombinant Human IL4R protein(Met1-His232), His-tagged, Biotinylated | +Inquiry |
IL4R-068H | Recombinant Human IL4R Protein, C-His-tagged | +Inquiry |
IL4R-2437P | Recombinant Pig IL4R Protein (33-240 aa), His-sumostar-tagged | +Inquiry |
IL4R-4281H | Recombinant Human IL4R Protein (Met1-His232), C-Fc tagged | +Inquiry |
◆ Native Proteins | ||
IL4R-44H | Active Recombinant Human IL4R Homodimer Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4R-1051RCL | Recombinant Rat IL4R cell lysate | +Inquiry |
IL4R-2719HCL | Recombinant Human IL4R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL4R Products
Required fields are marked with *
My Review for All IL4R Products
Required fields are marked with *