Recombinant Human IL6R Protein, C-His-tagged
Cat.No. : | IL6R-070H |
Product Overview : | Recombinant Human IL6R Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The IL-6 receptor is a heterodimeric complex that consists of a ligand-binding IL-6 receptor α (IL-6Rα) subunit and a signaling component, gp130. Binding of IL-6 to IL-6Rα results in dimerization of receptor with gp130 and subsequent STAT3 activation (1). IL-6Rα is cleaved from the cell surface by ADAM17. In humans, soluble IL-6Rα is also generated via alternatively spliced mRNA. Soluble IL-6Rα binds to IL-6 and can stimulate signaling via membrane bound gp130 in a process known as “trans-signaling”. It is through trans-signaling that IL-6 stimulates cells that do not express membrane bound IL-6Rα. |
Molecular Mass : | ~38 kDa |
AA Sequence : | LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | IL6R interleukin 6 receptor [ Homo sapiens (human) ] |
Official Symbol | IL6R |
Synonyms | IL6R; interleukin 6 receptor; interleukin-6 receptor subunit alpha; CD126; IL-6R 1; CD126 antigen; membrane glycoprotein 80; IL-6 receptor subunit alpha; gp80; IL6RA; IL-6RA; IL-6R-1; MGC104991; |
Gene ID | 3570 |
mRNA Refseq | NM_000565 |
Protein Refseq | NP_000556 |
MIM | 147880 |
UniProt ID | P08887 |
◆ Recombinant Proteins | ||
IL6R-3837H | Recombinant Human IL6R Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IL6R-1560R | Recombinant Rhesus Monkey IL6R Protein, hIgG1-tagged | +Inquiry |
IL6R-144H | Recombinant Human IL6R protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL6R-0186M | Active Recombinant Mouse IL6R protein, His-Avi-tagged, Biotinylated | +Inquiry |
IL6R-457R | Active Recombinant Rhesus IL6R Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IL6R-46H | Active Recombinant Human IL6R Homodimer Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6R-2903HCL | Recombinant Human IL6R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6R Products
Required fields are marked with *
My Review for All IL6R Products
Required fields are marked with *