Recombinant Human IL6ST Protein, GST-tagged

• Cat.No.: IL6ST-5171H
• Product Overview: Human IL6ST partial ORF ( NP_002175, 23 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine receptor complex. The activation of this protein is dependent upon the binding of cytokines to their receptors. vIL6, a protein related to IL6 and encoded by the Kaposi sarcoma-associated herpesvirus, can bypass the interleukin 6 receptor (IL6R) and directly activate this protein. Knockout studies in mice suggested a critical role of the gene encoding this protein in regulating myocyte apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
• Molecular Mass: 36.74 kDa
• AA Sequence: ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IL6ST interleukin 6 signal transducer (gp130, oncostatin M receptor) [ Homo sapiens ]
• Official Symbol: IL6ST
• Synonyms: IL6ST; interleukin 6 signal transducer (gp130, oncostatin M receptor); interleukin-6 receptor subunit beta; CD130; GP130; CD130 antigen; IL-6R subunit beta; membrane glycoprotein 130; IL-6 receptor subunit beta; membrane glycoprotein gp130; interleukin receptor beta chain; oncostatin-M receptor subunit alpha; gp130 of the rheumatoid arthritis antigenic peptide-bearing soluble form; CDW130; IL-6RB; DKFZp564F053
• Gene ID: 3572
• mRNA Refseq: NM_001190981
• Protein Refseq: NP_001177910
• MIM: 600694
• UniProt ID: P40189