Recombinant Human IL7R
Cat.No. : | IL7R-29272TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 21-236 of Human IL7R alpha fused to the Fc region of Human IgG1 expressed in modified Human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 21-236 a.a. |
Description : | The protein encoded by this gene is a receptor for interleukine 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleukine 2, 4, 7, 9, and 15. This protein has been shown to play a critical role in the V(D)J recombination during lymphocyte development. This protein is also found to control the accessibility of the TCR gamma locus by STAT5 and histone acetylation. Knockout studies in mice suggested that blocking apoptosis is an essential function of this protein during differentiation and activation of T lymphocytes. The functional defects in this protein may be associated with the pathogenesis of the severe combined immunodeficiency (SCID). |
Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS |
Storage : | Store at +4°C. |
Sequences of amino acids : | Theoretical Sequence:ESGYAQNGDLEDAELDDYSFSCYSQLEVN GSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRK LQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIV KPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMH DVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKV RSIPDHYFKGFWSEWSPSYYFRTPEINNSSGGIPKVDK KVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNKALP APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK |
Sequence Similarities : | Belongs to the type I cytokine receptor family. Type 4 subfamily.Contains 1 fibronectin type-III domain. |
Gene Name | IL7R interleukin 7 receptor [ Homo sapiens ] |
Official Symbol | IL7R |
Synonyms | IL7R; interleukin 7 receptor; interleukin-7 receptor subunit alpha; CD127; |
Gene ID | 3575 |
mRNA Refseq | NM_002185 |
Protein Refseq | NP_002176 |
MIM | 146661 |
Uniprot ID | P16871 |
Chromosome Location | 5p13 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; IL-7 Signaling Pathway, organism-specific biosystem; |
Function | antigen binding; interleukin-7 receptor activity; protein binding; receptor activity; |
◆ Recombinant Proteins | ||
IL7R-217H | Recombinant Human IL7R Protein (ECD), Fc-His-tagged(C-ter) | +Inquiry |
IL7R-291R | Recombinant Rat Il7r, His tagged | +Inquiry |
Il7r-1953R | Recombinant Rat Il7r protein, His & T7-tagged | +Inquiry |
IL7R-788H | Recombinant Human IL7R, Fc-His tagged | +Inquiry |
IL7R-367C | Recombinant Cynomolgus Monkey IL7R Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7R-2473MCL | Recombinant Mouse IL7R cell lysate | +Inquiry |
IL7R-959RCL | Recombinant Rat IL7R cell lysate | +Inquiry |
IL7R-2595HCL | Recombinant Human IL7R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL7R Products
Required fields are marked with *
My Review for All IL7R Products
Required fields are marked with *
0
Inquiry Basket