Recombinant Human ILK protein, His-tagged
Cat.No. : | ILK-3586H |
Product Overview : | Recombinant Human ILK protein(102-451 aa), fused to His tag, was expressed in E. coli. |
Availability | July 22, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 102-451 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ILK integrin-linked kinase [ Homo sapiens ] |
Official Symbol | ILK |
Synonyms | ILK; integrin-linked kinase; integrin-linked protein kinase; ILK-1; p59ILK; integrin-linked kinase-2; 59 kDa serine/threonine-protein kinase; P59; ILK-2; DKFZp686F1765; |
Gene ID | 3611 |
mRNA Refseq | NM_001014794 |
Protein Refseq | NP_001014794 |
MIM | 602366 |
UniProt ID | Q13418 |
◆ Recombinant Proteins | ||
ILK-1179H | Recombinant Human ILK Protein (1-228 aa), His-tagged | +Inquiry |
ILK-2635H | Recombinant Human ILK Protein (Asn183-Lys452), N-His tagged | +Inquiry |
ILK-5158H | Recombinant Human ILK Protein, GST-tagged | +Inquiry |
ILK-2708R | Recombinant Rat ILK Protein, His (Fc)-Avi-tagged | +Inquiry |
ILK-4906HFL | Recombinant Full Length Human ILK, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ILK-5219HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
ILK-5220HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ILK Products
Required fields are marked with *
My Review for All ILK Products
Required fields are marked with *