Recombinant Human ILK protein, His-tagged
| Cat.No. : | ILK-3586H |
| Product Overview : | Recombinant Human ILK protein(102-451 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 102-451 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | VPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ILK integrin-linked kinase [ Homo sapiens ] |
| Official Symbol | ILK |
| Synonyms | ILK; integrin-linked kinase; integrin-linked protein kinase; ILK-1; p59ILK; integrin-linked kinase-2; 59 kDa serine/threonine-protein kinase; P59; ILK-2; DKFZp686F1765; |
| Gene ID | 3611 |
| mRNA Refseq | NM_001014794 |
| Protein Refseq | NP_001014794 |
| MIM | 602366 |
| UniProt ID | Q13418 |
| ◆ Recombinant Proteins | ||
| ILK-2259R | Recombinant Rhesus monkey ILK Protein, His-tagged | +Inquiry |
| ILK-904H | Recombinant Human Integrin-Linked Kinase, His-tagged | +Inquiry |
| ILK-7343H | Recombinant Human ILK protein, His-tagged | +Inquiry |
| ILK-5726H | Recombinant Human ILK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ILK-10850Z | Recombinant Zebrafish ILK | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ILK-5220HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
| ILK-5219HCL | Recombinant Human ILK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ILK Products
Required fields are marked with *
My Review for All ILK Products
Required fields are marked with *
