Recombinant Human INIP Protein, GST-Tagged
Cat.No. : | INIP-0214H |
Product Overview : | Human C9orf80 full-length ORF (NP_067041.1, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a subunit of single-stranded DNA binding complexes that are important for maintaining genome stability. These complexes are involved in G2/M checkpoint control and homologous recombination repair. [provided by RefSeq, Jul 2016] |
Molecular Mass : | 37.8 kDa |
AA Sequence : | MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | INIP INTS3 and NABP interacting protein [ Homo sapiens ] |
Official Symbol | INIP |
Synonyms | MISE; SOSSC; SSBIP1; C9orf80; HSPC043; hSSBIP1; RP11-276E15.2 |
Gene ID | 58493 |
mRNA Refseq | NM_021218 |
Protein Refseq | NP_067041 |
MIM | 613273 |
UniProt ID | Q9NRY2 |
◆ Recombinant Proteins | ||
INIP-3269HF | Recombinant Full Length Human INIP Protein, GST-tagged | +Inquiry |
INIP-622C | Recombinant Cynomolgus INIP Protein, His-tagged | +Inquiry |
INIP-0214H | Recombinant Human INIP Protein, GST-Tagged | +Inquiry |
INIP-1764H | Recombinant Human INIP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Inip-3540M | Recombinant Mouse Inip Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INIP-7924HCL | Recombinant Human C9orf80 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INIP Products
Required fields are marked with *
My Review for All INIP Products
Required fields are marked with *