Active Recombinant Full Length Human INS Protein, C-Flag-tagged
Cat.No. : | INS-191HFL |
Product Overview : | Recombinant Full Length Human INS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified, including insulin-dependent diabetes mellitus, permanent neonatal diabetes diabetes mellitus, maturity-onset diabetes of the young type 10 and hyperproinsulinemia. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 9.3 kDa |
AA Sequence : | MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG GPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways : | Insulin signaling pathway, Maturity onset diabetes of the young, mTOR signaling pathway, Oocyte meiosis, Progesterone-mediated oocyte maturation, Prostate cancer, Regulation of actin cytoskeleton, Regulation of autophagy, Type I diabetes mellitus, Type II diabetes mellitus |
Full Length : | Full L. |
Gene Name | INS insulin [ Homo sapiens (human) ] |
Official Symbol | INS |
Synonyms | IDDM; ILPR; IRDN; IDDM1; IDDM2; PNDM4; MODY10 |
Gene ID | 3630 |
mRNA Refseq | NM_000207.3 |
Protein Refseq | NP_000198.1 |
MIM | 176730 |
UniProt ID | P01308 |
◆ Recombinant Proteins | ||
INS-679R | Recombinant Rabbit INS Protein, His/GST-tagged | +Inquiry |
INS-88H | Active Recombinant Human INS, His-tagged | +Inquiry |
INS-2369H | Recombinant Human INS Protein (Phe25-Asn110), N-GST tagged | +Inquiry |
INS-29H | Recombinant Human INS protein | +Inquiry |
INS-341H | Recombinant Human INS | +Inquiry |
◆ Native Proteins | ||
INS-512D | Native Bovine INS | +Inquiry |
INS-5435B | Native Bovine Insulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *
0
Inquiry Basket