Recombinant Human INSL3 protein, His-tagged
Cat.No. : | INSL3-3601H |
Product Overview : | Recombinant Human INSL3 protein(17-131 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 17-131 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LVFALGPAPTPEMREKLCGHHFVRALVRVCGGPRWSTEARRPAAGGDRELLQWLERRHLLHGLVADSNLTLGPGLQPLPQTSHHHRHHRAAATNPARYCCLSGCTQQDLLTLCPY |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | INSL3 insulin-like 3 (Leydig cell) [ Homo sapiens ] |
Official Symbol | INSL3 |
Synonyms | INSL3; insulin-like 3 (Leydig cell); relaxin like factor , RLNL; insulin-like 3; MGC119818; MGC119819; RLF; ley-I-L; relaxin-like factor b; leydig insulin-like peptide; leydig insulin -like hormone; leydig insulin -like peptide; RLNL; |
Gene ID | 3640 |
mRNA Refseq | NM_005543 |
Protein Refseq | NP_005534 |
MIM | 146738 |
UniProt ID | P51460 |
◆ Recombinant Proteins | ||
INSL3-1047H | Recombinant Human INSL3 protein, His & T7-tagged | +Inquiry |
INSL3-384H | Active Recombinant Human Insulin-Like 3 (Leydig cell) | +Inquiry |
Insl3-1062R | Recombinant Rat Insl3 Protein, His&SUMO-tagged | +Inquiry |
Insl3-1048R | Recombinant Rat Insl3 protein, His & GST-tagged | +Inquiry |
INSL3-7764B | Recombinant Bovine INSL3 protein, His-KSI-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INSL3-5191HCL | Recombinant Human INSL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INSL3 Products
Required fields are marked with *
My Review for All INSL3 Products
Required fields are marked with *
0
Inquiry Basket