Recombinant Human INSL4 Protein, GST-tagged
| Cat.No. : | INSL4-5096H |
| Product Overview : | Human INSL4 full-length ORF ( AAH26254, 26 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | INSL4 encodes the insulin-like 4 protein, a member of the insulin superfamily. INSL4 encodes a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. Expression of INSL4 products occurs within the early placental cytotrophoblast and syncytiotrophoblast. [provided by RefSeq |
| Molecular Mass : | 38.28 kDa |
| AA Sequence : | AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | INSL4 insulin-like 4 (placenta) [ Homo sapiens ] |
| Official Symbol | INSL4 |
| Synonyms | INSL4; insulin-like 4 (placenta); early placenta insulin-like peptide; EPIL; insulin-like peptide 4; early placenta insulin-like peptide (EPIL); PLACENTIN; |
| Gene ID | 3641 |
| mRNA Refseq | NM_002195 |
| Protein Refseq | NP_002186 |
| MIM | 600910 |
| UniProt ID | Q14641 |
| ◆ Recombinant Proteins | ||
| INSL4-3117H | Recombinant Human INSL4 Protein (Ala26-Thr139), C-His tagged | +Inquiry |
| INSL4-118H | Recombinant Human INSL4, His-tagged | +Inquiry |
| INSL4-5984HF | Recombinant Full Length Human INSL4 Protein, GST-tagged | +Inquiry |
| INSL4-5096H | Recombinant Human INSL4 Protein, GST-tagged | +Inquiry |
| INSL4-319H | Recombinant Human INSL4 protein(Met1-Thr139), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INSL4-001HCL | Recombinant Human INSL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSL4 Products
Required fields are marked with *
My Review for All INSL4 Products
Required fields are marked with *
