Recombinant Human INSL5 protein, GST-tagged
| Cat.No. : | INSL5-301251H |
| Product Overview : | Recombinant Human INSL5 (49-135 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | His49-Cys135 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | HLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | INSL5 insulin-like 5 [ Homo sapiens ] |
| Official Symbol | INSL5 |
| Synonyms | INSL5; insulin-like 5; insulin-like peptide INSL5; insulin-like peptide 5; PRO182; UNQ156; MGC126695; MGC126697; |
| Gene ID | 10022 |
| mRNA Refseq | NM_005478 |
| Protein Refseq | NP_005469 |
| MIM | 606413 |
| UniProt ID | Q9Y5Q6 |
| ◆ Recombinant Proteins | ||
| INSL5-5095H | Recombinant Human INSL5 Protein, GST-tagged | +Inquiry |
| Insl5-3554M | Recombinant Mouse Insl5 Protein, Myc/DDK-tagged | +Inquiry |
| INSL5-228H | Recombinant Human INSL5 Protein | +Inquiry |
| Insl5-1049M | Recombinant Mouse Insl5 protein, His & GST-tagged | +Inquiry |
| INSL5-301251H | Recombinant Human INSL5 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INSL5-5190HCL | Recombinant Human INSL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSL5 Products
Required fields are marked with *
My Review for All INSL5 Products
Required fields are marked with *



