Recombinant Human INSL5 Protein, GST-tagged
| Cat.No. : | INSL5-5095H |
| Product Overview : | Human INSL5 full-length ORF ( NP_005469, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene contains a classical signature of the insulin superfamily and is highly similar to relaxin 3 (RLN3/INSL7). [provided by RefSeq |
| Molecular Mass : | 40.48 kDa |
| AA Sequence : | MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHLEGIPQAQQAETGNSFQLPHKREFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | INSL5 insulin-like 5 [ Homo sapiens ] |
| Official Symbol | INSL5 |
| Synonyms | INSL5; insulin-like 5; insulin-like peptide INSL5; insulin-like peptide 5; PRO182; UNQ156; MGC126695; MGC126697; |
| Gene ID | 10022 |
| mRNA Refseq | NM_005478 |
| Protein Refseq | NP_005469 |
| MIM | 606413 |
| UniProt ID | Q9Y5Q6 |
| ◆ Recombinant Proteins | ||
| INSL5-2274H | Recombinant Human INSL5 Protein, MYC/DDK-tagged | +Inquiry |
| Insl5-3554M | Recombinant Mouse Insl5 Protein, Myc/DDK-tagged | +Inquiry |
| INSL5-301251H | Recombinant Human INSL5 protein, GST-tagged | +Inquiry |
| INSL5-5095H | Recombinant Human INSL5 Protein, GST-tagged | +Inquiry |
| Insl5-1049M | Recombinant Mouse Insl5 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INSL5-5190HCL | Recombinant Human INSL5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSL5 Products
Required fields are marked with *
My Review for All INSL5 Products
Required fields are marked with *
