Recombinant Human INSR protein(601-750 aa), C-hFc & C-His-tagged

Cat.No. : INSR-2566H
Product Overview : Recombinant Human INSR protein(P06213)(601-750 aa), fused with C-terminal hFc and C-terminal His tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc&His
Protein Length : 601-750 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGT
Gene Name INSR insulin receptor [ Homo sapiens ]
Official Symbol INSR
Synonyms INSR; insulin receptor; CD220; IR; HHF5;
Gene ID 3643
mRNA Refseq NM_000208
Protein Refseq NP_000199
MIM 147670
UniProt ID P06213

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INSR Products

Required fields are marked with *

My Review for All INSR Products

Required fields are marked with *

0
cart-icon