Recombinant Human INSR protein(601-750 aa), C-hFc & C-His-tagged

• Cat.No.: INSR-2566H
• Product Overview: Recombinant Human INSR protein(P06213)(601-750 aa), fused with C-terminal hFc and C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&His
• Protein Length: 601-750 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGT

Gene Information

• Gene Name: INSR insulin receptor [ Homo sapiens ]
• Official Symbol: INSR
• Synonyms: INSR; insulin receptor; CD220; IR; HHF5
• Gene ID: 3643
• mRNA Refseq: NM_000208
• Protein Refseq: NP_000199
• MIM: 147670
• UniProt ID: P06213